Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47580 349 / 1e-122 U1A spliceosomal protein U1A (.1) AT2G30260 249 / 3e-83 U2B'' U2 small nuclear ribonucleoprotein B (.1) AT1G06960 246 / 4e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G29400 50 / 1e-06 AML5 MEI2-like protein 5 (.1.2) AT2G37340 49 / 1e-06 RSZ33, ATRSZ33, RS2Z33, AT-RS2Z33 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) AT4G12640 43 / 0.0002 RNA recognition motif (RRM)-containing protein (.1) AT3G21215 41 / 0.0006 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G34110 41 / 0.0008 PABP2, PAB2, ATPAB2 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) AT1G09230 40 / 0.001 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G127800 [exp] 434 / 4e-156 AT2G47580 347 / 6e-122 spliceosomal protein U1A (.1) Potri.019G121400 [exp] 251 / 3e-84 AT2G30260 305 / 7e-106 U2 small nuclear ribonucleoprotein B (.1) Potri.013G153700 [exp] 247 / 2e-82 AT2G30260 297 / 8e-103 U2 small nuclear ribonucleoprotein B (.1) Potri.006G224900 [exp] 54 / 2e-08 AT1G21320 122 / 2e-33 nucleotide binding;nucleic acid binding (.1.2) Potri.012G019300 [exp] 52 / 7e-08 AT1G76940 167 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.001G067300 [exp] 53 / 1e-07 AT5G61960 627 / 0.0 MEI2-like protein 1 (.1.2) Potri.012G107100 [exp] 52 / 1e-07 AT5G07290 750 / 0.0 MEI2-like 4 (.1) Potri.015G009000 [exp] 51 / 1e-07 AT1G76940 170 / 8e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.015G106000 [exp] 52 / 2e-07 AT5G61960 767 / 0.0 MEI2-like protein 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003358 [exp] 385 / 5e-137 AT2G47580 367 / 7e-130 spliceosomal protein U1A (.1) Lus10008424 [exp] 384 / 3e-136 AT2G47580 365 / 4e-129 spliceosomal protein U1A (.1) Lus10042240 [exp] 247 / 1e-82 AT2G30260 352 / 2e-124 U2 small nuclear ribonucleoprotein B (.1) Lus10026413 [exp] 245 / 1e-81 AT2G30260 350 / 1e-123 U2 small nuclear ribonucleoprotein B (.1) Lus10043204 [exp] 50 / 1e-06 AT5G61960 728 / 0.0 MEI2-like protein 1 (.1.2) Lus10032537 [exp] 50 / 1e-06 AT5G61960 664 / 0.0 MEI2-like protein 1 (.1.2) Lus10011968 [exp] 49 / 2e-06 AT1G29400 900 / 0.0 MEI2-like protein 5 (.1.2) Lus10004591 [exp] 49 / 2e-06 AT1G29400 908 / 0.0 MEI2-like protein 5 (.1.2) Lus10020769 [exp] 49 / 3e-06 AT1G29400 786 / 0.0 MEI2-like protein 5 (.1.2) Lus10007346 [exp] 49 / 3e-06 AT1G29400 779 / 0.0 MEI2-like protein 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0221 [poplar] [flax] RRM PF13893 [poplar] [flax] RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.002G203600.1 pacid=42780100 polypeptide=Potri.002G203600.1.p locus=Potri.002G203600 ID=Potri.002G203600.1.v4.1 annot-version=v4.1 ATGGCATTGCTGGAGAGAAAAGACATGGCTGATGTGAATAACAATATCAATAATAATAGTAGCACAGGTACTGAAGTCTCTTCGAACATGACTATTTACA TCAATAACCTCAACGAAAAAATCAAAATCGATGAGTTGAAGAAAGCTCTGCACGCTGTGTTCTCGCAATTCGGGAAGATACTGGAGATATTGGCATTCAA GACATTGAAACACAAAGGGCAAGCTTGGGTTGTTTTTGAGGATGTTCAGTCTGCCTCTAATGCCATGAGGCAAATGCAGTCTTTCCCCTTTTATGATAAG CCCATGAGAATACAATATGCAAAAACTAAATCAGATATTGTAGCAAAGGCTGATGGTACTTTTGTTCCTCGGGAAAAACGAAGGAGGCATGAGGAAAAAG GGAAAAAGAAGAAAGATCAACATGATACTAATCAAGTGGGAGTGGGTCTGACTCCTGCATATGGCGGCGCCTACGGGACAACACCTCCTCTTTCTCAAAT ACCCTATCTAGGTGGTGTGAAATCTATGGTCCCTGAGGCTCCAGCTCCTCCAAATAACATTCTGTTTATTCAAAATCTTCCCAATGAGACTACTACAATG ATGCTGCAAATGTTATTCCAGCAGTACGCTGGTTTTAAGGAGGTCAGGATGGTGGAAACAAAGCCTGGGATTGCCTTTGTGGAGTACGGAGATGAGATGC AATCAACAGTCGCTATGCATGCACTTCAGGGTTTCAAGTTACAGCAGAATTCAATGTTAATTACCTATGCCAAGAAATAG
AA sequence Show only first row Show all	>Potri.002G203600.1 pacid=42780100 polypeptide=Potri.002G203600.1.p locus=Potri.002G203600 ID=Potri.002G203600.1.v4.1 annot-version=v4.1 MALLERKDMADVNNNINNNSSTGTEVSSNMTIYINNLNEKIKIDELKKALHAVFSQFGKILEILAFKTLKHKGQAWVVFEDVQSASNAMRQMQSFPFYDK PMRIQYAKTKSDIVAKADGTFVPREKRRRHEEKGKKKKDQHDTNQVGVGLTPAYGGAYGTTPPLSQIPYLGGVKSMVPEAPAPPNNILFIQNLPNETTTM MLQMLFQQYAGFKEVRMVETKPGIAFVEYGDEMQSTVAMHALQGFKLQQNSMLITYAKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47580		U1A	spliceosomal protein U1A (.1)		Potri.002G203600 [exp]	0	1
AT5G14140	C2H2ZnF		zinc ion binding;nucleic acid ...		Potri.001G329300 [exp]	1.00	0.8650
AT3G63030		MBD4	methyl-CPG-binding domain 4 (....		Potri.002G212600 [exp]	2.44	0.8281	MBD911
AT5G13070			MSF1-like family protein (.1)		Potri.001G018500 [exp]	3.46	0.7963
AT1G43860			sequence-specific DNA binding ...		Potri.002G073200 [exp]	5.65	0.7718
AT5G58110			chaperone binding;ATPase activ...		Potri.006G080900 [exp]	6.32	0.8578
AT3G46460		UBC13	ubiquitin-conjugating enzyme 1...		Potri.010G206832 [exp]	6.63	0.8041
AT3G07140			GPI transamidase component Gpi...		Potri.014G190600 [exp]	8.71	0.7627
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.008G090700 [exp]	9.79	0.7225
AT5G25450			Cytochrome bd ubiquinol oxidas...		Potri.006G250000 [exp]	10.95	0.7760
					Potri.001G400401 [exp]	12.00	0.7868

Compare expression of checked genes

Potri.002G203600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.