Potri.002G207500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47930 45 / 1e-06 AGP26, ATAGP26 ARABIDOPSIS THALIANA ARABINOGALACTAN PROTEIN 26, arabinogalactan protein 26 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G135100 116 / 3e-34 AT2G47930 47 / 2e-07 ARABIDOPSIS THALIANA ARABINOGALACTAN PROTEIN 26, arabinogalactan protein 26 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G207500.1 pacid=42780223 polypeptide=Potri.002G207500.1.p locus=Potri.002G207500 ID=Potri.002G207500.1.v4.1 annot-version=v4.1
ATGGCTTCCTTTTGCTCAATATTCTTGGCAATGTTCACGGTCTTTATGGCCTATTTTTCCTCACCAGCTTTGACATCTCAAATACACGTACAGTTCTCTA
CTATATCAGCAGCCCCTGCATTTTTGCATGATGCCCCCTCATTCTCTCCTCCAACTTTATCACCAGATATTGAACCGTTGTTTCCTACTCCTGGAGTTGG
AGCACCTTCTCCTACTGAGTCATCAATACCAACCATTCCTTCAAATCCAAGCCCTCCAAATCCAGATGACATGCTAGCTCCTGGCCCTGCAGGATCGTCA
ATTTCACCATCTGGTTCTTTGCCAGCCTATTCTTCAGTGTCTCTAACTTCATCAGGACCTTTAAACTTAGCTGTTTTTCTTGGTTTGCTGGTGTTTTGCT
TAGTGCAGCCTTCTGGTATCATGTGA
AA sequence
>Potri.002G207500.1 pacid=42780223 polypeptide=Potri.002G207500.1.p locus=Potri.002G207500 ID=Potri.002G207500.1.v4.1 annot-version=v4.1
MASFCSIFLAMFTVFMAYFSSPALTSQIHVQFSTISAAPAFLHDAPSFSPPTLSPDIEPLFPTPGVGAPSPTESSIPTIPSNPSPPNPDDMLAPGPAGSS
ISPSGSLPAYSSVSLTSSGPLNLAVFLGLLVFCLVQPSGIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G47930 AGP26, ATAGP26 ARABIDOPSIS THALIANA ARABINOGA... Potri.002G207500 0 1
AT4G38650 Glycosyl hydrolase family 10 p... Potri.004G173300 1.00 0.9174
AT1G24764 ATMAP70-2 microtubule-associated protein... Potri.006G039200 3.46 0.9094
AT3G55420 unknown protein Potri.010G203900 3.60 0.8599
AT5G39420 CDC2CAT CDC2C (.1) Potri.017G088200 3.87 0.9021
AT1G69080 Adenine nucleotide alpha hydro... Potri.008G109000 6.00 0.8868
AT1G09390 GDSL-like Lipase/Acylhydrolase... Potri.002G191100 6.32 0.8508
AT1G30690 Sec14p-like phosphatidylinosit... Potri.001G461400 6.48 0.8796
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.001G065900 10.48 0.8627
AT4G24780 Pectin lyase-like superfamily ... Potri.001G339500 12.44 0.8367
AT2G38970 Zinc finger (C3HC4-type RING f... Potri.008G038450 13.74 0.8778

Potri.002G207500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.