Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrGrx20
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1) AT1G03020 155 / 6e-51 Thioredoxin superfamily protein (.1) AT5G18600 135 / 6e-43 Thioredoxin superfamily protein (.1) AT4G15680 128 / 5e-40 Thioredoxin superfamily protein (.1) AT4G15700 127 / 2e-39 Thioredoxin superfamily protein (.1) AT4G15690 126 / 3e-39 Thioredoxin superfamily protein (.1) AT4G15660 122 / 9e-38 Thioredoxin superfamily protein (.1) AT4G15670 122 / 1e-37 Thioredoxin superfamily protein (.1) AT3G21460 113 / 5e-34 Glutaredoxin family protein (.1) AT2G47870 109 / 2e-32 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G134000 [exp] 202 / 3e-69 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.014G133800 [exp] 146 / 4e-47 AT1G03020 142 / 1e-45 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 145 / 1e-46 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.014G133700 [exp] 145 / 1e-46 AT3G62930 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.014G133900 [exp] 144 / 4e-46 AT3G62930 141 / 4e-45 Thioredoxin superfamily protein (.1) Potri.002G209000 [exp] 133 / 6e-42 AT3G62930 140 / 6e-45 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 121 / 2e-37 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 119 / 2e-36 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 118 / 4e-36 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029440 [exp] 156 / 4e-51 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 152 / 2e-49 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 152 / 2e-49 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10005940 [exp] 141 / 4e-45 AT3G62930 137 / 2e-43 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 128 / 5e-40 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 128 / 7e-40 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 114 / 3e-34 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10040898 [exp] 101 / 3e-29 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 100 / 5e-29 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 98 / 2e-27 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.002G208700.1 pacid=42779687 polypeptide=Potri.002G208700.1.p locus=Potri.002G208700 ID=Potri.002G208700.1.v4.1 annot-version=v4.1 ATGGATATCGTGAGAAGGTTGGTTGCGGACAGGCCAGTGGTGATTTTTAGCAGGAGCACTTGTTGCATGAGCCACTCCATTAAAACACTTATATCTAGCT TTGGGGCAAATCCTACAGTTTATGAGCTAGATCAAATTCCAAACGGGAAGCAAATTGAAAGAGCATTAGTACAGCAGCTAGGATGTCAGCCAAGTGTACC AACTGTTTTCATAGGCCAAGAGTTTGTTGGTGGTGATAAGCAAGTCATGAGCTTACAAGTCAGGAATGAGCTAGGCTCTTTGCTTAGGAAGGCAGGAGCT ATATGGATTTGA
AA sequence Show only first row Show all	>Potri.002G208700.1 pacid=42779687 polypeptide=Potri.002G208700.1.p locus=Potri.002G208700 ID=Potri.002G208700.1.v4.1 annot-version=v4.1 MDIVRRLVADRPVVIFSRSTCCMSHSIKTLISSFGANPTVYELDQIPNGKQIERALVQQLGCQPSVPTVFIGQEFVGGDKQVMSLQVRNELGSLLRKAGA IWI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62930			Thioredoxin superfamily protei...		Potri.002G208700 [exp]	0	1	PtrGrx20
AT4G24340			Phosphorylase superfamily prot...		Potri.013G100800 [exp]	3.46	0.8185
AT4G24340			Phosphorylase superfamily prot...		Potri.013G100700 [exp]	4.24	0.8184
AT3G51750			unknown protein		Potri.016G124000 [exp]	5.91	0.7583
AT3G62930			Thioredoxin superfamily protei...		Potri.002G209000 [exp]	6.00	0.7783
					Potri.006G183466 [exp]	6.92	0.8009
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.007G139400 [exp]	7.74	0.8009
AT5G59590		UGT76E2	UDP-glucosyl transferase 76E2 ...		Potri.006G039300 [exp]	9.16	0.6901
AT5G18600			Thioredoxin superfamily protei...		Potri.010G021800 [exp]	10.00	0.6952
AT1G02065	SBP	SPL8	squamosa promoter binding prot...		Potri.002G142200 [exp]	11.48	0.6096
AT3G56380		ARR17	response regulator 17 (.1)		Potri.019G133600 [exp]	11.95	0.6813

Compare expression of checked genes

Potri.002G208700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.