Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ACO2,ACO1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05010 440 / 1e-156 ACO4, EAT1, EFE ethylene forming enzyme, ethylene-forming enzyme (.1) AT1G12010 419 / 4e-148 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G62380 410 / 6e-145 ATACO2, ACO2 ACC oxidase 2 (.1) AT2G19590 273 / 8e-91 ATACO1, ACO1 ACC oxidase 1 (.1) AT1G77330 272 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 171 / 2e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 166 / 1e-48 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 166 / 1e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 164 / 6e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 161 / 7e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G159000 [exp] 551 / 0 AT1G05010 464 / 8e-166 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.011G020900 [exp] 490 / 2e-176 AT1G05010 473 / 1e-169 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.004G003000 [exp] 483 / 2e-173 AT1G05010 467 / 6e-167 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.002G078600 [exp] 298 / 9e-101 AT1G77330 455 / 1e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G182700 [exp] 296 / 5e-100 AT1G77330 461 / 4e-165 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G151600 [exp] 281 / 3e-94 AT2G19590 462 / 2e-165 ACC oxidase 1 (.1) Potri.008G069300 [exp] 181 / 2e-54 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G188000 [exp] 179 / 2e-53 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 174 / 1e-51 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029992 [exp] 474 / 6e-170 AT1G05010 496 / 2e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10035334 [exp] 471 / 8e-169 AT1G05010 495 / 6e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10015153 [exp] 464 / 6e-166 AT1G05010 501 / 1e-180 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10031530 [exp] 462 / 2e-165 AT1G05010 498 / 3e-179 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10028678 [exp] 286 / 5e-96 AT1G77330 435 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000857 [exp] 280 / 2e-93 AT1G77330 440 / 2e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008564 [exp] 273 / 2e-90 AT2G19590 423 / 6e-150 ACC oxidase 1 (.1) Lus10005037 [exp] 166 / 3e-48 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 159 / 4e-46 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004387 [exp] 158 / 2e-45 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.002G224100.1 pacid=42779460 polypeptide=Potri.002G224100.1.p locus=Potri.002G224100 ID=Potri.002G224100.1.v4.1 annot-version=v4.1 ATGGAGTTCCCAGTGATTAACATGGAGAAGCTTAATGGTGAGGAGAGAGCTGCCACCATGGAAAAGATCAGAGATGCCTGCGAGAACTGGGGCTTCTTTG AGCTGTTGAACCATGGCATAGCCCATGAATTCTTGGACACTGTGGAGAGAATGGCAAAAGAACACTACAAGAAAGGCATGGAGCAAAGGTTCAAGGAATT GGTGGCAAGCAAAGCCCTTGTGGGTGTCCAAACAGAGATCAAAGATATGGACTGGGAGAGCACCTTCCACTTGCGACATCTCCCCATGTCTAACATTGCT GAGATCCCCGATCTCGATGATGAGTACAGGAAGGTGATGAAAGAATTCGCATTGAAGCTGGAGAAACTGGCAGAGGAGCTTCTGGACTTGTTATGTGAGA ACCTTGGACTTGAAAAGGGGTACCTCAAAAGGGCTTTCTGTGGATCTAGCGGTAGTCCAAACTTTGGGACCAAGGTTAGCAATTATCCACCGTGCCCCAA GCCAGACCTGGTCAAGGGTCTCAGGGCCCACACAGATGCTGGTGGCATCATCTTGCTTTTCCAGGATGACAAGGTCAGCGGTCTGCAGCTTCTGAAGGAT GGCCAGTGGATTGATGTGCCTCCAATGCGCCACTCCATTGTCGTCAACCTTGGTGACCAGCTTGAGGTGATCACCAATGGCAAGTATAAGAGCGTGGAGC ACAGAGTGATTGCTCAAACAGACGGCACTAGGATGTCGATAGCTTCTTTCTACAACCCTGGAAACGATGCAGTTATCTATCCAGCACCAGCTTTGGTGGA GAAAGAAGCAGAGGAGAAGAAACATCTGTACCCGAAATTTGTATTTGATGACTATATGAAGCTGTATGCTGGGCTCAAATTCCAAGCCAAGGAGCCAAGA TTTGAAGCCATGAAAGCTGTAGAAACTAACGTCTAA
AA sequence Show only first row Show all	>Potri.002G224100.1 pacid=42779460 polypeptide=Potri.002G224100.1.p locus=Potri.002G224100 ID=Potri.002G224100.1.v4.1 annot-version=v4.1 MEFPVINMEKLNGEERAATMEKIRDACENWGFFELLNHGIAHEFLDTVERMAKEHYKKGMEQRFKELVASKALVGVQTEIKDMDWESTFHLRHLPMSNIA EIPDLDDEYRKVMKEFALKLEKLAEELLDLLCENLGLEKGYLKRAFCGSSGSPNFGTKVSNYPPCPKPDLVKGLRAHTDAGGIILLFQDDKVSGLQLLKD GQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVEHRVIAQTDGTRMSIASFYNPGNDAVIYPAPALVEKEAEEKKHLYPKFVFDDYMKLYAGLKFQAKEPR FEAMKAVETNV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Potri.002G224100 [exp]	0	1	ACO2,ACO1.1
AT4G37290			unknown protein		Potri.007G049400 [exp]	4.35	0.9856
AT5G52400		CYP715A1	"cytochrome P450, family 715, ...		Potri.012G142000 [exp]	6.32	0.9783
					Potri.006G038300 [exp]	8.48	0.9821
AT5G33280			Voltage-gated chloride channel...		Potri.018G124100 [exp]	9.38	0.9378
AT3G04350			Plant protein of unknown funct...		Potri.002G256802 [exp]	11.22	0.9651
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Potri.007G118600 [exp]	15.96	0.9793
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Potri.001G384200 [exp]	16.24	0.8998
AT1G72680		ATCAD1	CINNAMYL ALCOHOL DEHYDROGENASE...		Potri.003G196700 [exp]	17.14	0.9788
AT3G11840		PUB24	plant U-box 24 (.1)		Potri.009G016100 [exp]	17.66	0.9791
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Potri.003G087000 [exp]	19.07	0.9682

Compare expression of checked genes

Potri.002G224100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.