Potri.002G224200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03965 116 / 7e-33 RING/U-box superfamily protein (.1)
AT4G22250 108 / 1e-29 RING/U-box superfamily protein (.1)
AT1G62370 107 / 2e-29 RING/U-box superfamily protein (.1)
AT3G25030 98 / 3e-25 RING/U-box superfamily protein (.1.2)
AT4G13100 96 / 2e-24 RING/U-box superfamily protein (.1.2.3.4.5)
AT3G07120 77 / 6e-17 RING/U-box superfamily protein (.1)
AT2G34920 47 / 2e-06 EDA18 embryo sac development arrest 18, RING/U-box superfamily protein (.1)
AT3G58720 46 / 3e-06 RING/U-box superfamily protein (.1.2)
AT3G06140 44 / 2e-05 RING/U-box superfamily protein (.1)
AT1G63900 43 / 3e-05 DAL1 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G158900 221 / 2e-74 AT4G22250 103 / 2e-27 RING/U-box superfamily protein (.1)
Potri.004G003101 108 / 1e-29 AT4G03965 135 / 3e-39 RING/U-box superfamily protein (.1)
Potri.002G243800 97 / 7e-24 AT3G07120 191 / 3e-57 RING/U-box superfamily protein (.1)
Potri.007G081900 48 / 1e-06 AT2G22010 1712 / 0.0 related to KPC1 (.1.2)
Potri.013G025400 45 / 1e-05 AT5G19080 303 / 5e-100 RING/U-box superfamily protein (.1)
Potri.005G083800 45 / 1e-05 AT2G22010 1726 / 0.0 related to KPC1 (.1.2)
Potri.014G159300 45 / 1e-05 AT2G32950 1091 / 0.0 FUSCA 1, EMBRYO DEFECTIVE 168, DEETIOLATED MUTANT 340, ARABIDOPSIS THALIANA CONSTITUTIVE PHOTOMORPHOGENIC 1, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.003G156400 44 / 2e-05 AT2G34920 172 / 5e-45 embryo sac development arrest 18, RING/U-box superfamily protein (.1)
Potri.005G093000 44 / 3e-05 AT5G23110 5932 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035335 120 / 2e-35 AT4G22250 114 / 4e-33 RING/U-box superfamily protein (.1)
Lus10029993 119 / 4e-35 AT4G03965 118 / 2e-34 RING/U-box superfamily protein (.1)
Lus10015152 119 / 3e-34 AT4G03965 123 / 1e-35 RING/U-box superfamily protein (.1)
Lus10025921 81 / 2e-18 AT3G07120 117 / 3e-31 RING/U-box superfamily protein (.1)
Lus10038180 81 / 3e-18 AT3G07120 122 / 6e-33 RING/U-box superfamily protein (.1)
Lus10002487 45 / 2e-05 AT5G01450 347 / 5e-115 RING/U-box superfamily protein (.1)
Lus10016817 44 / 3e-05 AT2G22010 1406 / 0.0 related to KPC1 (.1.2)
Lus10034030 44 / 4e-05 AT5G19080 344 / 1e-116 RING/U-box superfamily protein (.1)
Lus10035857 44 / 5e-05 AT2G22010 1667 / 0.0 related to KPC1 (.1.2)
Lus10027994 43 / 5e-05 AT1G63900 532 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Potri.002G224200.1 pacid=42777986 polypeptide=Potri.002G224200.1.p locus=Potri.002G224200 ID=Potri.002G224200.1.v4.1 annot-version=v4.1
ATGAACAGCTTAGACGGGATCACAATGACGGGGTGGAAGAATCTAAAGCAACGGCTGTCATTCAAGGGCCTTGGTGGTTGCTGCGGGAGCACAAGCTGGA
GTTCCAGAAGTGAAACTCCAACCATGCCCTTCATCGATATGGAGGAGGAAGAAGAAGAAGAGAGTGCCATTATGCAGAACCAAGCACAAGGAGGAGGGTT
TGCTGCAGCCCCAGGTGCAGGGATGAATCTGGCAATGGCATTAGCTGCTGAGCGCAATTCACGGGCTTCAAACGTCAAGACATTGATGAGATTGATTGAA
GAAACGGACGGTGTTGATTGGAGGACGAAGAACAAGACTAATAAAAGTAGGAGGGACAAAGAACAGGAACAGGGACCAGAGAATGATTGGGTGTGCTGCG
TGTGCATGGAGAGAAAGAAAGGCGCAGCTTTTATTCCATGTGGACACGCCTTTTGTAGGGTTTGTTCAAGAGAAATGTGGGTCAATCGAGGGTCTTGCCC
CATCTGCAACCGTTCAATTCTCGACATCCTTGATATCTTTTAG
AA sequence
>Potri.002G224200.1 pacid=42777986 polypeptide=Potri.002G224200.1.p locus=Potri.002G224200 ID=Potri.002G224200.1.v4.1 annot-version=v4.1
MNSLDGITMTGWKNLKQRLSFKGLGGCCGSTSWSSRSETPTMPFIDMEEEEEEESAIMQNQAQGGGFAAAPGAGMNLAMALAAERNSRASNVKTLMRLIE
ETDGVDWRTKNKTNKSRRDKEQEQGPENDWVCCVCMERKKGAAFIPCGHAFCRVCSREMWVNRGSCPICNRSILDILDIF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G03965 RING/U-box superfamily protein... Potri.002G224200 0 1
AT3G17365 S-adenosyl-L-methionine-depend... Potri.010G153200 6.70 0.8735
AT4G24580 REN1 ROP1 ENHANCER 1, Rho GTPase ac... Potri.002G104300 8.48 0.8701
AT4G35930 F-box family protein (.1) Potri.005G110200 9.59 0.8772
AT1G03620 ELMO/CED-12 family protein (.1... Potri.013G136200 10.48 0.8680
AT4G34160 CYCD3;1 CYCLIN D3;1 (.1) Potri.001G301800 10.95 0.8639
Potri.001G456700 14.42 0.8087
AT1G76520 Auxin efflux carrier family pr... Potri.011G145600 15.29 0.8464
AT1G06920 OFP ATOFP4, OFP4 ARABIDOPSIS THALIANA OVATE FAM... Potri.016G134200 15.87 0.8033
AT3G19590 BUB3.1 BUB \(BUDDING UNINHIBITED BY B... Potri.009G089200 18.49 0.8747
AT5G67200 Leucine-rich repeat protein ki... Potri.005G141200 18.70 0.8540

Potri.002G224200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.