Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SUM1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55160 171 / 6e-57 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2) AT4G26840 168 / 9e-56 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) AT5G55170 103 / 5e-30 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1) AT5G55856 96 / 2e-27 Ubiquitin-like superfamily protein (.1) AT5G48710 81 / 3e-21 Ubiquitin-like superfamily protein (.1) AT2G32765 74 / 3e-18 ATSUMO5, SUM5 SUMO 5, small ubiquitinrelated modifier 5 (.1) AT5G48700 71 / 3e-17 Ubiquitin-like superfamily protein (.1) AT5G55855 48 / 9e-09 Ubiquitin-like superfamily protein (.1) AT1G68185 47 / 3e-07 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G224800 [exp] 206 / 5e-71 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2) Potri.014G158300 [exp] 203 / 8e-70 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2) Potri.014G190300 [exp] 175 / 1e-58 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2) Potri.010G118900 [exp] 51 / 8e-09 AT1G68185 164 / 7e-51 Ubiquitin-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043185 [exp] 171 / 7e-57 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10032560 [exp] 171 / 7e-57 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10032561 [exp] 171 / 8e-57 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10043184 [exp] 103 / 1e-30 AT5G55160 108 / 2e-32 small ubiquitin-like modifier 2 (.1.2) Lus10026174 [exp] 62 / 1e-12 AT1G53520 259 / 3e-84 Chalcone-flavanone isomerase family protein (.1) Lus10022539 [exp] 56 / 2e-11 AT5G55160 61 / 5e-14 small ubiquitin-like modifier 2 (.1.2) Lus10000234 [exp] 52 / 7e-09 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1) Lus10034627 [exp] 52 / 7e-09 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1) Lus10035259 [exp] 50 / 2e-08 AT1G68185 156 / 3e-47 Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF11976 [poplar] [flax] Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Potri.002G224700.1 pacid=42779516 polypeptide=Potri.002G224700.1.p locus=Potri.002G224700 ID=Potri.002G224700.1.v4.1 annot-version=v4.1 ATGTCTGAGGCGACAGGTCAGCCACAAGAGGAAGATAAGAAGCCCAACGATCAGTCTGCTCACATCAACCTCAAAGTGAAGGGCCAGGATGGAAATGAAG TCTTTTTCAGGATCAAAAGAAGCACGCAGTTGAAGAAGCTGATGAATGCCTATTGTGATCGCCAATCTGTTGAGATAAACTCAATTGCCTTCTTGTTTGA TGGTCGTCGTCTTCGTGGAGAGCAAACTCCTGATGAGCTGGACATGGAGGATGGGGATGAGATTGATGCTATGTTGCACCAAACTGGTGGTGCTGTGAAA GCAAGTGATTATGCTTGA
AA sequence Show only first row Show all	>Potri.002G224700.1 pacid=42779516 polypeptide=Potri.002G224700.1.p locus=Potri.002G224700 ID=Potri.002G224700.1.v4.1 annot-version=v4.1 MSEATGQPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEINSIAFLFDGRRLRGEQTPDELDMEDGDEIDAMLHQTGGAVK ASDYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G26840		ATSUMO1, SUMO1,...	ARABIDOPSIS THALIANA SMALL UBI...		Potri.002G224700 [exp]	0	1	Pt-SUM1.1
AT2G20480			unknown protein		Potri.001G009501 [exp]	1.41	0.8466
AT3G21690			MATE efflux family protein (.1...		Potri.011G002500 [exp]	2.64	0.8555
AT2G28270			Cysteine/Histidine-rich C1 dom...		Potri.001G229900 [exp]	2.82	0.8226
AT1G02280		PPI1, ATTOC33, ...	PLASTID PROTEIN IMPORT 1, tran...		Potri.002G183400 [exp]	3.16	0.8201	Pt-PPI1.3
AT4G22150		PUX3	plant UBX domain-containing pr...		Potri.004G004200 [exp]	5.47	0.7850
AT1G48910		YUC10	YUCCA 10, Flavin-containing mo...		Potri.002G207400 [exp]	6.70	0.8289
AT5G06770	C3HZnF		KH domain-containing protein /...		Potri.003G213200 [exp]	7.21	0.7681
AT4G27760		FEY3, FEY	FOREVER YOUNG, NAD(P)-binding ...		Potri.003G182000 [exp]	8.48	0.8142
AT1G34300			lectin protein kinase family p...		Potri.019G086400 [exp]	10.58	0.7958
AT2G38550			Transmembrane proteins 14C (.1...		Potri.016G137200 [exp]	12.00	0.7841

Compare expression of checked genes

Potri.002G224700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.