Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32990 201 / 5e-63 ATGH9B8 glycosyl hydrolase 9B8 (.1) AT1G64390 150 / 3e-43 ATGH9C2 glycosyl hydrolase 9C2 (.1) AT4G11050 149 / 2e-42 ATGH9C3 glycosyl hydrolase 9C3 (.1) AT2G44550 125 / 2e-34 ATGH9B10 glycosyl hydrolase 9B10 (.1) AT1G48930 125 / 7e-34 ATGH9C1 glycosyl hydrolase 9C1 (.1) AT2G44540 122 / 2e-33 ATGH9B9 glycosyl hydrolase 9B9 (.1) AT3G43860 117 / 2e-31 ATGH9A4 glycosyl hydrolase 9A4 (.1) AT2G44570 116 / 4e-31 ATGH9B12 glycosyl hydrolase 9B12 (.1) AT1G19940 108 / 2e-28 ATGH9B5 glycosyl hydrolase 9B5 (.1) AT2G44560 108 / 3e-28 ATGH9B11 glycosyl hydrolase 9B11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G157600 [exp] 253 / 8e-83 AT2G32990 800 / 0.0 glycosyl hydrolase 9B8 (.1) Potri.001G356000 [exp] 182 / 8e-56 AT2G32990 736 / 0.0 glycosyl hydrolase 9B8 (.1) Potri.001G092200 [exp] 149 / 1e-42 AT1G64390 951 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.003G139600 [exp] 145 / 2e-41 AT1G64390 999 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.007G071200 [exp] 144 / 9e-41 AT1G48930 850 / 0.0 glycosyl hydrolase 9C1 (.1) Potri.006G219700 [exp] 122 / 4e-33 AT3G43860 689 / 0.0 glycosyl hydrolase 9A4 (.1) Potri.002G202400 [exp] 115 / 8e-31 AT4G02290 818 / 0.0 glycosyl hydrolase 9B13 (.1) Potri.002G023900 [exp] 115 / 1e-30 AT1G19940 672 / 0.0 glycosyl hydrolase 9B5 (.1) Potri.001G083200 [exp] 111 / 2e-29 AT1G02800 593 / 0.0 cellulase 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030007 [exp] 200 / 1e-65 AT2G32990 330 / 2e-111 glycosyl hydrolase 9B8 (.1) Lus10035316 [exp] 203 / 9e-64 AT2G32990 751 / 0.0 glycosyl hydrolase 9B8 (.1) Lus10009724 [exp] 176 / 4e-53 AT2G32990 693 / 0.0 glycosyl hydrolase 9B8 (.1) Lus10001833 [exp] 151 / 3e-43 AT1G64390 965 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10032377 [exp] 145 / 3e-41 AT1G64390 989 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10010201 [exp] 140 / 3e-39 AT1G48930 812 / 0.0 glycosyl hydrolase 9C1 (.1) Lus10003888 [exp] 138 / 2e-38 AT1G64390 960 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10025880 [exp] 118 / 9e-32 AT1G71380 646 / 0.0 ARABIDOPSIS THALIANA GLYCOSYL HYDROLASE 9B3, cellulase 3 (.1) Lus10033957 [exp] 118 / 1e-31 AT1G64390 797 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10038223 [exp] 115 / 2e-30 AT4G02290 706 / 0.0 glycosyl hydrolase 9B13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0059 [poplar] [flax] 6_Hairpin PF00759 [poplar] [flax] Glyco_hydro_9 Glycosyl hydrolase family 9
Representative CDS sequence Show only first row Show all	>Potri.002G225400.2 pacid=42778201 polypeptide=Potri.002G225400.2.p locus=Potri.002G225400 ID=Potri.002G225400.2.v4.1 annot-version=v4.1 ATGCAATATGTATCAACTGCAGCCTTCCTTCTCACTTTATACTCCGATATCCTTCGAAACTCGACTCAAAAGCTCAAGTGCTATGGAGGGTCTGTGGATT ACCAAGAGATACTCCATTTTGCTAAATCTCAAGTTGATTACATCCTAGGTTCTAACCCAATGAACATGAGTTATTTAGTGGGTTATGGCCGTAAATACCC CACAAGAGTGCACCATAGAGGGGCCTCAATGGTGCCATACAGAGAGAGCATGGGGTTCATTGGGTGCACCCAAGGGTTCGACCTCTGGTATGGTCGGGAA GAGCCCAACCCTAATGTTGTAGTCGGGGCAGTGGTTGGAGGACCTGATTGTCAAGATAATTTCATGGACCAGAGAGGAAATTACATGCAGACTGAGGCCT GCACGTATAATACAGCACCACTAGTCGGAGTTTTTGCCAAGTTGTTGCAAATGGAAGACCAAAAGAGATAG
AA sequence Show only first row Show all	>Potri.002G225400.2 pacid=42778201 polypeptide=Potri.002G225400.2.p locus=Potri.002G225400 ID=Potri.002G225400.2.v4.1 annot-version=v4.1 MQYVSTAAFLLTLYSDILRNSTQKLKCYGGSVDYQEILHFAKSQVDYILGSNPMNMSYLVGYGRKYPTRVHHRGASMVPYRESMGFIGCTQGFDLWYGRE EPNPNVVVGAVVGGPDCQDNFMDQRGNYMQTEACTYNTAPLVGVFAKLLQMEDQKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32990		ATGH9B8	glycosyl hydrolase 9B8 (.1)		Potri.002G225400 [exp]	0	1
AT2G45340			Leucine-rich repeat protein ki...		Potri.014G068700 [exp]	7.00	0.8116
AT1G31300			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.012G118100 [exp]	10.58	0.7977
AT1G76070			unknown protein		Potri.005G245600 [exp]	15.09	0.7865
AT1G04410		c-NAD-MDH1	cytosolic-NAD-dependent malate...		Potri.002G141700 [exp]	16.12	0.7699
AT3G59500			Integral membrane HRF1 family ...		Potri.014G175900 [exp]	19.49	0.7977
AT1G55210			Disease resistance-responsive ...		Potri.003G216200 [exp]	22.00	0.7630
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Potri.011G167000 [exp]	27.27	0.7324	PtrAAP10
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Potri.001G279500 [exp]	27.49	0.7623
AT5G23720		PHS1	PROPYZAMIDE-HYPERSENSITIVE 1, ...		Potri.015G105000 [exp]	32.37	0.7774	Pt-PHS1.2
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Potri.005G184400 [exp]	37.64	0.7620	GA20ox3

Compare expression of checked genes

Potri.002G225400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.