Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08000 63 / 2e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 52 / 4e-09 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT4G13850 49 / 4e-08 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT5G47320 42 / 3e-05 RPS19 ribosomal protein S19 (.1) AT5G55550 40 / 0.0002 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G157300 [exp] 96 / 1e-26 AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G059000 [exp] 47 / 1e-07 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.006G208500 [exp] 47 / 2e-07 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 44 / 3e-06 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.001G236300 [exp] 41 / 2e-05 AT4G13850 88 / 1e-23 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.001G319800 [exp] 41 / 4e-05 AT4G13850 137 / 2e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.012G061600 [exp] 40 / 0.0001 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.009G160300 [exp] 38 / 0.0003 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G222400 [exp] 38 / 0.0009 AT3G07810 439 / 8e-151 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031534 [exp] 73 / 2e-17 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015146 [exp] 72 / 7e-17 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10016639 [exp] 46 / 7e-07 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10022551 [exp] 45 / 1e-06 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10032591 [exp] 41 / 5e-05 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10013306 [exp] 39 / 0.0002 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043158 [exp] 38 / 0.0005 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G225700.2 pacid=42777501 polypeptide=Potri.002G225700.2.p locus=Potri.002G225700 ID=Potri.002G225700.2.v4.1 annot-version=v4.1 ATGAAGAACGAGAGGTCAGAAATCTTGTCAGTTGCTAGAAAAGCTTTAACGAAAGCTTACAATCCAAATTCTCTCACTATCACTGATAAACTATTTTTTG CAGGTTTGTCATGGTCAGTTGACGAGAAGTCATTAAAAGATGCTTTCTCTTCCTTTGGAGATACAGTGGCAGATCGGTTTGTCAGTTTTTCTAAAGAAGA TGAGGCTGTTTCTGCAAAAGATGCAATGGATTGGAAGGTGACCATGGCTTTGATAGTAAATAATTTCATTGCAGGCATTGTTAGGTCGTCCATTGAGGAT AAGCTATGCTCTGAAGGAGTTCGAGGCGGACCAGTCGGTGTCCCTCGCCTTCCAAATGGAGGAGATGGTGCCTCTAATGGCAATGCTTGA
AA sequence Show only first row Show all	>Potri.002G225700.2 pacid=42777501 polypeptide=Potri.002G225700.2.p locus=Potri.002G225700 ID=Potri.002G225700.2.v4.1 annot-version=v4.1 MKNERSEILSVARKALTKAYNPNSLTITDKLFFAGLSWSVDEKSLKDAFSSFGDTVADRFVSFSKEDEAVSAKDAMDWKVTMALIVNNFIAGIVRSSIED KLCSEGVRGGPVGVPRLPNGGDGASNGNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Potri.002G225700 [exp]	0	1
AT5G04520			Protein of unknown function DU...		Potri.010G233000 [exp]	7.68	0.7034
AT4G33990		EMB2758	embryo defective 2758, Tetratr...		Potri.012G111900 [exp]	14.79	0.6454
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Potri.006G208500 [exp]	17.32	0.6287
AT5G64200		ATSC35, At-SC35	ARABIDOPSIS THALIANA ORTHOLOG ...		Potri.002G095800 [exp]	30.62	0.6009
AT1G48170			unknown protein		Potri.008G099700 [exp]	35.09	0.5985
AT2G43465			RNA-binding ASCH domain protei...		Potri.007G132100 [exp]	35.32	0.6168
AT1G28340		AtRLP4	receptor like protein 4 (.1)		Potri.004G047300 [exp]	39.57	0.5745
AT4G33100			unknown protein		Potri.006G224400 [exp]	42.73	0.6077
AT4G17180			O-Glycosyl hydrolases family 1...		Potri.006G002100 [exp]	44.49	0.6062
AT2G14285			Small nuclear ribonucleoprotei...		Potri.006G167000 [exp]	56.83	0.5609

Compare expression of checked genes

Potri.002G225700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.