Plant FIBer expression Database

Potri.002G226300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05065 40 / 1e-05 CLE20 CLAVATA3/ESR-RELATED 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156600
[exp]
86 / 8e-24 AT1G05065 / CLAVATA3/ESR-RELATED 20 (.1)
Potri.012G138200
[exp]
35 / 0.0006 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.002G226300.1 pacid=42779479 polypeptide=Potri.002G226300.1.p locus=Potri.002G226300 ID=Potri.002G226300.1.v4.1 annot-version=v4.1
ATGAAACTCTTTCAACTCTGCCTCATCGTTGCTCTTCTGATTGTCTTTGGCAGCTCTCCGAGGAGGAGTCACGCAATCCGGGGGAGCTCTTCTGCACCTT
CCACAAGCCAGCAAGTCTTTCGCTCTCCATTTAGTCCTTCGCCCTTTGCACAGAGAGCTGAAGAATTCGCGTCACAGAAGCGCAGGGTTCCAGCAGGCCC
GAATCCATTGCATAACAAGCGATAA
AA sequence
>Potri.002G226300.1 pacid=42779479 polypeptide=Potri.002G226300.1.p locus=Potri.002G226300 ID=Potri.002G226300.1.v4.1 annot-version=v4.1
MKLFQLCLIVALLIVFGSSPRRSHAIRGSSSAPSTSQQVFRSPFSPSPFAQRAEEFASQKRRVPAGPNPLHNKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05065 CLE20 CLAVATA3/ESR-RELATED 20 (.1) Potri.002G226300
[exp]
0 1
AT4G17050 UGLYAH ureidoglycine aminohydrolase (... Potri.003G083600
[exp]
3.46 0.7617
AT2G30080 ATZIP6, ZIP6 ZIP metal ion transporter fami... Potri.009G074100
[exp]
8.94 0.7634 ZIP6.2
AT1G08170 Histone superfamily protein (.... Potri.001G212200
[exp]
9.21 0.7520
AT5G15710 Galactose oxidase/kelch repeat... Potri.004G112400
[exp]
13.19 0.6798
AT2G40460 Major facilitator superfamily ... Potri.019G055800
[exp]
13.85 0.7461
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G038200
[exp]
15.49 0.7603
AT1G05630 AT5PTASE13, 5PT... Endonuclease/exonuclease/phosp... Potri.017G006900
[exp]
16.73 0.7188
AT2G40160 TBL30 Plant protein of unknown funct... Potri.008G070101
[exp]
19.89 0.7266
AT1G63440 HMA5 heavy metal atpase 5 (.1) Potri.001G019100
[exp]
21.63 0.7134
AT1G78020 Protein of unknown function (D... Potri.005G078600
[exp]
23.91 0.7255

Potri.002G226300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.