Potri.002G228101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G161366 41 / 0.0001 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G228101.1 pacid=42776787 polypeptide=Potri.002G228101.1.p locus=Potri.002G228101 ID=Potri.002G228101.1.v4.1 annot-version=v4.1
ATGGACAACACTTTAGCAGAAACAAAATGGACAACCGATACAGGTGCCTCCAACCATATGACAGGACAATCAGGTATGTTAACCAACCTTCGTAAATATA
AGGGAGCTGACTCTATAATTATAGGAAATGGATCCTCAATACCAATCCTTGGTATTGGGGATACACAAATTAAACAGCAGAAAATTGCTTTACCTCTTCG
AGATGTCTTATTAGTCCCTACGCTAACGAAAAATTTACTATCGGTAAGTCAGTTGACTAAGCAATTTCCTGTTAACTGTGAGTTTTCTAACGTTGATTTT
TATGTCAAGGAACGAAAGACAGGACAACCAGTAATCACAGGGACTCGCAAGGGTGATCTTTATGTCCTTCCGACTTCACCAAAACTATATTTCTCAACAA
GATTTAGAACAGGTTCTGCTGAAGTGTGGCACCAGCGTCTAGGACACCCACAATTCTTAGCTTTACAATTGTTGAAAATAAGGGCTTGA
AA sequence
>Potri.002G228101.1 pacid=42776787 polypeptide=Potri.002G228101.1.p locus=Potri.002G228101 ID=Potri.002G228101.1.v4.1 annot-version=v4.1
MDNTLAETKWTTDTGASNHMTGQSGMLTNLRKYKGADSIIIGNGSSIPILGIGDTQIKQQKIALPLRDVLLVPTLTKNLLSVSQLTKQFPVNCEFSNVDF
YVKERKTGQPVITGTRKGDLYVLPTSPKLYFSTRFRTGSAEVWHQRLGHPQFLALQLLKIRA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G228101 0 1
AT2G04050 MATE efflux family protein (.1... Potri.004G094650 12.48 0.6298
AT4G39130 Dehydrin family protein (.1) Potri.009G120100 19.51 0.6235
Potri.016G037100 32.68 0.5775
Potri.001G459001 46.28 0.5679
AT5G06860 ATPGIP1, PGIP1 polygalacturonase inhibiting p... Potri.016G049600 59.86 0.5534 PGIP.2
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.010G042400 64.48 0.5449 Pt-INO.2
AT2G46950 CYP709B2 "cytochrome P450, family 709, ... Potri.006G022200 66.35 0.5483 Pt-CYP709.2
AT1G04645 Plant self-incompatibility pro... Potri.018G148366 74.83 0.5380
AT1G75490 AP2_ERF DREB2D Integrase-type DNA-binding sup... Potri.002G029400 79.32 0.5391
Potri.015G076300 91.97 0.5167

Potri.002G228101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.