Potri.002G231501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05790 100 / 7e-25 lipase class 3 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G150800 265 / 6e-85 AT1G05790 622 / 0.0 lipase class 3 family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019567 171 / 2e-51 AT1G05790 399 / 4e-133 lipase class 3 family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.002G231501.2 pacid=42779303 polypeptide=Potri.002G231501.2.p locus=Potri.002G231501 ID=Potri.002G231501.2.v4.1 annot-version=v4.1
ATGACTCTACTGCAAACTGCGACTGCAATTTACCTTGTGTTTAGTGTGGCTGAATTTATGTCTCATGATGGAACATCAAGTAAATGTCTCACAGGGACAG
CTTCAAATGGTAACAAGTGGAAGACAAAACTACTCATTCCATTTGTTATCACAGTTTGTTCTGTTCCACTAATGCATTGTTTTGTGGGACCTGCAGTCCT
AAGATGGAGGTCTTTTTATGAAACCCAAGATGATGCATGGAAGGCACACTATCAGGAGGTGTTTGACCATGGAATTCGTGAGGCTTTGTGCTGCCTGGGG
CGTGTCAAATACATGGGGGCGCCTAAGGAAGATGAAGTTTACTCAGTAGCACGATTGTTGGGTGATCTTGTTGCCTATCGTGCATCAGGCACTGGGCATT
TGGAACTTCTAGCAGGTCTAGCTTTGTTGCAAAGGCATAGTGAATCACCTAAATCTCATGATGAAATGGTAGCAGAGAAAAGATTCGGGAGGCTTTTTCT
TTCCATCAATTTGCTGAAGCTGCATATACTGTACTTGTAA
AA sequence
>Potri.002G231501.2 pacid=42779303 polypeptide=Potri.002G231501.2.p locus=Potri.002G231501 ID=Potri.002G231501.2.v4.1 annot-version=v4.1
MTLLQTATAIYLVFSVAEFMSHDGTSSKCLTGTASNGNKWKTKLLIPFVITVCSVPLMHCFVGPAVLRWRSFYETQDDAWKAHYQEVFDHGIREALCCLG
RVKYMGAPKEDEVYSVARLLGDLVAYRASGTGHLELLAGLALLQRHSESPKSHDEMVAEKRFGRLFLSINLLKLHILYL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05790 lipase class 3 family protein ... Potri.002G231501 0 1
AT1G79190 ARM repeat superfamily protein... Potri.007G067700 2.00 0.9042
AT1G05790 lipase class 3 family protein ... Potri.002G231567 3.46 0.8906
AT1G05790 lipase class 3 family protein ... Potri.002G231534 4.24 0.8941
Potri.001G284801 7.21 0.8523
AT3G18860 transducin family protein / WD... Potri.009G112184 10.58 0.8208
AT5G49820 RUS6, EMB1879 ROOT UV-B SENSITIVE 6, Protein... Potri.004G229500 14.42 0.7684
AT1G43760 DNAse I-like superfamily prote... Potri.006G175087 15.49 0.8353
Potri.006G175050 17.97 0.8423
AT2G39930 ATISA1, ISA1 ARABIDOPSIS THALIANA ISOAMYLAS... Potri.006G070800 18.70 0.7856
AT1G16130 WAKL2 wall associated kinase-like 2 ... Potri.009G154300 22.44 0.8847

Potri.002G231501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.