Potri.002G231534 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05790 179 / 6e-54 lipase class 3 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G150800 247 / 4e-78 AT1G05790 622 / 0.0 lipase class 3 family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019567 183 / 6e-56 AT1G05790 399 / 4e-133 lipase class 3 family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.002G231534.1 pacid=42776825 polypeptide=Potri.002G231534.1.p locus=Potri.002G231534 ID=Potri.002G231534.1.v4.1 annot-version=v4.1
ATGAATGCCTTTTCGTCTCTCAGATGGCCCTCACTCTCTGGAGATAACTGGTGGCGGGGTCATGCAGCAGCTTTTTTAAAATATGTTAATTTACCCTCTG
AAGCTCTTCGACATGGTCGTGTTTGTCAGGAAAAATGTGAAGCTGCATACTTTGTTGTGGTTCTACATCATCTAAGATCTGTAGTGATCTCTGTCCGAGG
AACTGAGACCCCTGAAGACCTCATAACAGATGGTTTGGGCAGGGAATGCCTCCTTTCTAGAGACGACTTAGATGGATTGATAAATAGCAGCCATATTCAA
CCTGATGTGAAGCGAAGAGTGGAATCATCTTTCCCACACTATGGGCACTCTGGCATAGTTGAGGCTGCACGTGATCTTTATATTCAAATTGAAGGAGATC
TTGCAGATAATGGTAATCAGTATTTCTTTTTGCTTCATTACCTTTCGACCAAATTATCTTGGAAACAAATCATATTGCACATTCATGGATCTTTTGTTCT
TTGTTATATTAGCATGACCCTTCAATTTTGTAGAAGTACCCATGTCTGA
AA sequence
>Potri.002G231534.1 pacid=42776825 polypeptide=Potri.002G231534.1.p locus=Potri.002G231534 ID=Potri.002G231534.1.v4.1 annot-version=v4.1
MNAFSSLRWPSLSGDNWWRGHAAAFLKYVNLPSEALRHGRVCQEKCEAAYFVVVLHHLRSVVISVRGTETPEDLITDGLGRECLLSRDDLDGLINSSHIQ
PDVKRRVESSFPHYGHSGIVEAARDLYIQIEGDLADNGNQYFFLLHYLSTKLSWKQIILHIHGSFVLCYISMTLQFCRSTHV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05790 lipase class 3 family protein ... Potri.002G231534 0 1
AT1G05790 lipase class 3 family protein ... Potri.002G231567 1.41 0.9190
AT1G05790 lipase class 3 family protein ... Potri.002G231501 4.24 0.8941
AT1G16260 Wall-associated kinase family ... Potri.009G157201 6.00 0.9149
AT5G05800 unknown protein Potri.001G238000 7.74 0.9130
AT1G79190 ARM repeat superfamily protein... Potri.007G067700 11.61 0.8838
AT1G47580 Pentatricopeptide repeat (PPR)... Potri.002G130900 12.68 0.8775
Potri.006G175050 13.74 0.8787
AT5G05800 unknown protein Potri.015G012100 16.30 0.9164
AT3G24255 RNA-directed DNA polymerase (r... Potri.006G175124 21.97 0.9007
Potri.017G046700 23.36 0.8738

Potri.002G231534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.