Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31680 374 / 1e-133 AtRABA5d RAB GTPase homolog A5D (.1) AT1G05810 370 / 2e-131 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT2G43130 363 / 3e-129 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G07410 343 / 2e-121 AtRABA5b RAB GTPase homolog A5B (.1) AT5G47520 288 / 1e-99 AtRABA5a RAB GTPase homolog A5A (.1) AT1G07410 248 / 1e-83 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT1G09630 246 / 4e-83 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT5G59150 244 / 2e-82 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT4G18430 244 / 2e-82 AtRABA1e RAB GTPase homolog A1E (.1) AT5G60860 244 / 3e-82 AtRABA1f RAB GTPase homolog A1F (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G150300 [exp] 436 / 3e-158 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 336 / 2e-118 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.016G010300 [exp] 285 / 2e-98 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G015400 [exp] 282 / 3e-97 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.003G004100 [exp] 252 / 1e-85 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.010G197200 [exp] 246 / 4e-83 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 246 / 5e-83 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.001G270100 [exp] 245 / 2e-82 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.016G000400 [exp] 244 / 2e-82 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026731 [exp] 395 / 8e-142 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 395 / 8e-142 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038226 [exp] 318 / 3e-111 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10025876 [exp] 317 / 6e-111 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10000536 [exp] 291 / 1e-100 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10038807 [exp] 289 / 9e-100 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 288 / 3e-99 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10000637 [exp] 251 / 8e-85 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10023153 [exp] 250 / 2e-84 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 249 / 5e-84 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.002G231800.1 pacid=42779448 polypeptide=Potri.002G231800.1.p locus=Potri.002G231800 ID=Potri.002G231800.1.v4.1 annot-version=v4.1 ATGTCATCGGACGAAGAAGGGGGAGAGGAGTACCTGTTCAAGATCGTGATCATAGGGGATTCAGCAGTAGGAAAATCAAATCTGCTTTCTCGATATGCAA GAAATGAGTTCAATTTACATTCAAAGGCCACGATAGGAGTGGAGTTTCAGACCCAGAGCATGGAAATTGATGGCAAAGAAGTTAAGGCTCAGATTTGGGA CACTGCTGGCCAAGAGAGGTTCAGGGCTGTCACTTCTGCTTACTATAGAGGTGCTGTCGGTGCTCTCATTGTTTATGACATTAGTCGCCGTACTACTTTT GATAGTGTCGGTCGATGGCTTGATGAGCTTAAAACCCATTCTGATACAACTGTAGCAATGATGCTGGTTGGGAACAAGTGTGATTTGGAGAACATCAGGG ATGTTAGTGTGGAGGAGGGCAAAAGCCTTGCCGAAGCTGAAGGGTTGTTCTTCATGGAGACATCTGCCCTTGACTCAACAAATGTTAAAAAGGCTTTTGA GATTGTTATTCGAGAGATATATAACAACGTGAGCAGGAAGGTCTTGAATTCTGATACATACAAAGCTGAATTATCTCTGAATAGGGTAACCCTTGTTAAC AATGGGAGTGACTCCAAGCAAGCCCAAGGCTACTTTTCCTGCTGCTCCAGGTGA
AA sequence Show only first row Show all	>Potri.002G231800.1 pacid=42779448 polypeptide=Potri.002G231800.1.p locus=Potri.002G231800 ID=Potri.002G231800.1.v4.1 annot-version=v4.1 MSSDEEGGEEYLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTF DSVGRWLDELKTHSDTTVAMMLVGNKCDLENIRDVSVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAELSLNRVTLVN NGSDSKQAQGYFSCCSR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31680		AtRABA5d	RAB GTPase homolog A5D (.1)		Potri.002G231800 [exp]	0	1
AT3G27230			S-adenosyl-L-methionine-depend...		Potri.005G236600 [exp]	1.41	0.8651	Pt-RAD3.1
AT5G20520		WAV2	WAVY GROWTH 2, alpha/beta-Hydr...		Potri.018G064800 [exp]	2.82	0.8432
AT5G23540			Mov34/MPN/PAD-1 family protein...		Potri.014G032900 [exp]	2.82	0.8834
AT1G18210			Calcium-binding EF-hand family...		Potri.015G039500 [exp]	11.61	0.8112	Pt-CBL1.2
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Potri.016G139600 [exp]	12.84	0.8420	PAA1.4
AT5G18800			Cox19-like CHCH family protein...		Potri.008G196600 [exp]	15.19	0.8534
AT1G76200			unknown protein		Potri.005G248600 [exp]	17.20	0.8309
AT5G47570			unknown protein		Potri.001G122200 [exp]	17.66	0.8347
AT5G39850			Ribosomal protein S4 (.1)		Potri.011G094500 [exp]	18.73	0.8229
AT3G03070			NADH-ubiquinone oxidoreductase...		Potri.013G082100 [exp]	19.33	0.8269

Compare expression of checked genes

Potri.002G231800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.