Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RIC2.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16490 89 / 1e-22 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1) AT1G27380 56 / 3e-10 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2) AT2G33460 44 / 3e-05 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1) AT4G04900 43 / 3e-05 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1) AT2G20430 43 / 3e-05 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1) AT4G28556 43 / 3e-05 RIC7 PAK-box/P21-Rho-binding family protein (.1) AT1G04450 40 / 0.0004 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G147000 [exp] 213 / 4e-71 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.019G053300 [exp] 118 / 1e-33 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.013G086600 [exp] 114 / 2e-32 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.010G069500 [exp] 47 / 2e-06 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1) Potri.004G020650 [exp] 46 / 2e-06 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.008G168900 [exp] 46 / 5e-06 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1) Potri.002G035500 [exp] 45 / 8e-06 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1) Potri.011G025300 [exp] 44 / 1e-05 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.005G227500 [exp] 44 / 2e-05 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021974 [exp] 69 / 1e-14 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10041267 [exp] 69 / 4e-14 AT2G33460 55 / 5e-09 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10041106 [exp] 48 / 8e-07 AT5G16490 61 / 2e-11 ROP-interactive CRIB motif-containing protein 4 (.1) Lus10018362 [exp] 45 / 7e-06 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10007648 [exp] 44 / 1e-05 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10036433 [exp] 44 / 3e-05 AT5G16490 64 / 1e-12 ROP-interactive CRIB motif-containing protein 4 (.1) Lus10006763 [exp] 43 / 3e-05 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10003625 [exp] 42 / 8e-05 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00786 [poplar] [flax] PBD P21-Rho-binding domain
Representative CDS sequence Show only first row Show all	>Potri.002G233400.1 pacid=42779820 polypeptide=Potri.002G233400.1.p locus=Potri.002G233400 ID=Potri.002G233400.1.v4.1 annot-version=v4.1 ATGCATGCATGCCCCTTTCAGATTTCGTGTTTGATTTTGTTGTGTAAATCGAACATGAGAGATCGTAAGGAAAGATTTGTAGTTCTTCCCTTCTCCATCG GCTGTGCTTCTCAGTCTAGTGTTGCGGTGGCTACCGCCGCTGAACCCTGCAAGAAACCAAAACATGAGACCAAATCATCACATGCAACAAGAAGACGGGA AGGGGAAGAAAGCTCTTGTCAAGAAAAGACGAAGAGTAATACATTCAGTTCCCTGGCTCTTCCAAAGCCTAACATGTCCAGTGGCATGTACAAACTCGTT AGGGGCATTAAAAGCCTGTCCCAAATATTTGTGTACAAAGAAGATGATGACGACAGAATGGAAAGAGAGATGGAGATCGGATATCCGACTGATGTGAAGC ATTTAACACACATTGGATTGGATGGTTCCACTACTACAACGACAGCGACAAATCCTATTAAGGGCTGGGAAAGTCTGAAACCTCCAGAAATAATTTCATT CCCTTCTATTTCTTTAAGGCACTTAGAGCTTGCTATGGCTGCACAGGCTCATGGACCTCTAGTTGAGGTCGATCATTCCAGGCTCTCTTGA
AA sequence Show only first row Show all	>Potri.002G233400.1 pacid=42779820 polypeptide=Potri.002G233400.1.p locus=Potri.002G233400 ID=Potri.002G233400.1.v4.1 annot-version=v4.1 MHACPFQISCLILLCKSNMRDRKERFVVLPFSIGCASQSSVAVATAAEPCKKPKHETKSSHATRRREGEESSCQEKTKSNTFSSLALPKPNMSSGMYKLV RGIKSLSQIFVYKEDDDDRMEREMEIGYPTDVKHLTHIGLDGSTTTTTATNPIKGWESLKPPEIISFPSISLRHLELAMAAQAHGPLVEVDHSRLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.002G233400 [exp]	0	1	Pt-RIC2.2
AT3G49260		IQD21	IQ-domain 21 (.1.2.3)		Potri.012G016200 [exp]	2.64	0.9257
AT1G30900		VSR6, VSR3;3, B...	VACUOLAR SORTING RECEPTOR 3;3,...		Potri.003G155200 [exp]	3.74	0.9226
AT3G03550			RING/U-box superfamily protein...		Potri.013G073500 [exp]	6.92	0.9092
AT4G01850		AtSAM2, SAM-2, ...	S-adenosylmethionine synthetas...		Potri.014G114700 [exp]	6.92	0.9160	Pt-SAM1.1
AT5G43150			unknown protein		Potri.008G152200 [exp]	8.12	0.8941
AT1G27920		MAP65-8	microtubule-associated protein...		Potri.003G173300 [exp]	8.36	0.9077
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Potri.012G006400 [exp]	9.16	0.9166	OMT1.1
AT5G07250		ATRBL3	RHOMBOID-like protein 3 (.1.2)		Potri.015G142000 [exp]	10.39	0.9006
AT4G28500	NAC	ANAC073, SND2, ...	SECONDARY WALL-ASSOCIATED NAC ...		Potri.017G016700 [exp]	12.24	0.9152
AT3G03770			Leucine-rich repeat protein ki...		Potri.013G064300 [exp]	12.32	0.8839

Compare expression of checked genes

Potri.002G233400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.