Plant FIBer expression Database

Potri.002G235600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00800 130 / 4e-40 ATCG00800.1, RPS3 structural constituent of ribosome (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
Representative CDS sequence
>Potri.002G235600.1 pacid=42779473 polypeptide=Potri.002G235600.1.p locus=Potri.002G235600 ID=Potri.002G235600.1.v4.1 annot-version=v4.1
ATGAAAAAGGCTATTGAATTAACTGAGCAGAGCAATTCAAAAGGAATTCAAGTACAAATTGCAAAGCATCTTGATGGAAAAAAAATTGCACGCGCCGAAT
GGGTTAGAGAGGGCAGAGTTCCTTTACAAACTCTTCGAGCTAAAATTAATTATTGTTCTTATACAGTTAGAACTATTTATCGGGTTTTAGGTATAAAAAT
TTGGATATTTATAGACGAGGAATAG
AA sequence
>Potri.002G235600.1 pacid=42779473 polypeptide=Potri.002G235600.1.p locus=Potri.002G235600 ID=Potri.002G235600.1.v4.1 annot-version=v4.1
MKKAIELTEQSNSKGIQVQIAKHLDGKKIARAEWVREGRVPLQTLRAKINYCSYTVRTIYRVLGIKIWIFIDEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.002G235600
[exp]
0 1
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G137077
[exp]
5.74 0.9884
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.012G047500
[exp]
6.32 0.9866
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.019G027580
[exp]
8.12 0.9712
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.017G072340
[exp]
9.16 0.9829
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.011G075200
[exp]
12.48 0.9832
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301
[exp]
13.07 0.9851
Potri.008G210639
[exp]
13.71 0.9595
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401
[exp]
16.61 0.9834
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688
[exp]
17.74 0.9828
ATCG00210 ATCG00210.1, YC... electron transporter, transfer... Potri.013G142332
[exp]
19.44 0.9615

Potri.002G235600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.