Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31980 96 / 5e-26 AtCYS2 PHYTOCYSTATIN 2 (.1) AT5G47550 54 / 5e-10 Cystatin/monellin superfamily protein (.1) AT3G12490 53 / 4e-09 ATCYS6, ATCYSB ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) AT2G40880 50 / 8e-09 ATCYSA, FL3-27 cystatin A (.1) AT4G16500 44 / 2e-06 Cystatin/monellin superfamily protein (.1) AT5G05110 44 / 6e-06 Cystatin/monellin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149300 [exp] 146 / 5e-46 AT2G31980 90 / 1e-23 PHYTOCYSTATIN 2 (.1) Potri.003G192200 [exp] 50 / 3e-08 AT3G12490 303 / 6e-105 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.001G225800 [exp] 47 / 2e-07 AT3G12490 142 / 4e-44 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.016G030900 [exp] 47 / 4e-07 AT3G12490 244 / 5e-82 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.001G032900 [exp] 47 / 4e-07 AT3G12490 276 / 2e-95 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.009G022300 [exp] 45 / 5e-07 AT3G12490 134 / 4e-41 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.006G033201 [exp] 45 / 3e-06 AT3G12490 251 / 8e-86 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.006G014500 [exp] 43 / 5e-06 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041257 [exp] 97 / 1e-26 AT2G31980 72 / 9e-17 PHYTOCYSTATIN 2 (.1) Lus10026779 [exp] 46 / 3e-07 AT3G12490 129 / 2e-39 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Lus10026117 [exp] 47 / 7e-07 AT3G12490 261 / 2e-88 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Lus10008702 [exp] 47 / 8e-07 AT3G12490 241 / 9e-81 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0121 [poplar] [flax] Cystatin PF00031 [poplar] [flax] Cystatin Cystatin domain
Representative CDS sequence Show only first row Show all	>Potri.002G235800.1 pacid=42778833 polypeptide=Potri.002G235800.1.p locus=Potri.002G235800 ID=Potri.002G235800.1.v4.1 annot-version=v4.1 ATGGCAAGACTTGTGAAGTCCTCAGCACCCTTGTTTGTTTTTCTCGTTCTCTACACGCTTCTTGTGTCAGGAGTGAGTGGAAACGGCGGAGGGATGGTAG GCGGGAGAGCCAAGGTGAGTGATGTGAAGACTAACAAGGAGATTCAGGAGCTGGGAAGGTTCTCCGTGAAGGAGTTCAACAACCACAGGAGCACGTACGG GAAAGGTGGTGAGGTTGGAGAGCTGATGTTGTCTGAAGTGGTGGAGGCACAGACGCAGGTGGTTTCTGGGGTCAAGTATTATTTAAAGATTGAGGCAACC ACACAGAGTGAAGAGAAGCTTATGTTTGATTCGGTGCTTGTGGTCAAGCCTTGGCTCCGATCCAAGGAGTTGCTTGCCTTTGAGCCTTCCATTGGACTGA GGGTTTAG
AA sequence Show only first row Show all	>Potri.002G235800.1 pacid=42778833 polypeptide=Potri.002G235800.1.p locus=Potri.002G235800 ID=Potri.002G235800.1.v4.1 annot-version=v4.1 MARLVKSSAPLFVFLVLYTLLVSGVSGNGGGMVGGRAKVSDVKTNKEIQELGRFSVKEFNNHRSTYGKGGEVGELMLSEVVEAQTQVVSGVKYYLKIEAT TQSEEKLMFDSVLVVKPWLRSKELLAFEPSIGLRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31980		AtCYS2	PHYTOCYSTATIN 2 (.1)		Potri.002G235800 [exp]	0	1
AT3G09280			unknown protein		Potri.006G092200 [exp]	2.23	0.6272
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.001G468900 [exp]	20.29	0.6142
					Potri.006G031300 [exp]	20.34	0.5729
AT4G36600			Late embryogenesis abundant (L...		Potri.005G122400 [exp]	24.79	0.5805
AT3G57770			Protein kinase superfamily pro...		Potri.005G106600 [exp]	24.97	0.5668
AT1G68840	AP2_ERF	EDF2, RAV2, RAP...	TEMPRANILLO 2, RELATED TO AP2 ...		Potri.014G068000 [exp]	32.18	0.5621
AT1G01710			Acyl-CoA thioesterase family p...		Potri.002G159150 [exp]	37.41	0.5138
					Potri.011G153800 [exp]	42.57	0.5732
AT1G68920	bHLH	bHLH049, ACE1	basic helix-loop-helix (bHLH) ...		Potri.008G113200 [exp]	44.36	0.5720
					Potri.002G118950 [exp]	46.90	0.5065

Compare expression of checked genes

Potri.002G235800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.