Potri.002G236000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23710 351 / 7e-122 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
AT4G33350 165 / 1e-49 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G126800 164 / 4e-49 AT4G33350 374 / 7e-132 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.014G030000 164 / 5e-49 AT4G33350 359 / 5e-126 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022378 347 / 4e-120 AT3G23710 305 / 2e-103 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10007784 301 / 1e-102 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10006487 153 / 1e-44 AT4G33350 358 / 2e-125 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10009759 152 / 6e-44 AT4G33350 355 / 3e-124 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Potri.002G236000.4 pacid=42777125 polypeptide=Potri.002G236000.4.p locus=Potri.002G236000 ID=Potri.002G236000.4.v4.1 annot-version=v4.1
ATGAACTTCCTCCCTAAGTCCAACGACCAACAAATTTTCCCAGCATCCAAACAATCCCCGCAAATTGACCTCCACCATGCCTTTACCACTCTCCAAGACC
ACTGCTCTACATTTCTCCAAAACCTCTCTCACCAATTCCCTCTCTTCAATCCCAACTTCCAAACCCACGCAAAACAATCACTCGACACTCTTATCTCACG
CCTCAACCCCAACTCTCCCTTGTCCTCCAAGAACCCATTGTGGGCTCGAATTCCTCACGAGCCCGTTATTCAACCAGGCACTTCCATGTCAACTGAAACC
ATTGAAGAGAGATTGGCTGGCGTGCCTGTGTATGCTTTGAGTAATTCCAATGAAGAATTCGTGTTGGTTTCTGGGCTTTCAACGGGGAAGTCTCTTGGGT
TGTTTTGTTTCAAACAGGAGGATGCAGAGGCACTCCTTGAGCAAATGAAGAGCATGGACCCTGGAATGAGAAAAGGCGGCTCTAAAGTTGTTCCTGTTGC
GTTAAACAAGGTTTTTCAGTTAAAAGTTGATGGGGTGGCCTTTAGGTTGATACCGGAACCTTCACAAGTCAAGAATGCACTTATGGAAAGAGAGCGAGCT
GGTTTATCTGATGATTGCTTCTCCGGGGTTCCAGTTTTCCAGTCAAGGAGTTTGGTATTGAAAAGTCAAAACAGAAGCTATCGTCCAGTATTTTTTAGAA
AGGAGGATTTAGAAAAATCACTTTTAAGAGCTTCCCGTGAGCAGCATAAAGTAAATCCTGCCTTCAAGCAGGGGGATATCGAGGTTGCTGTTTTCGAAGA
GATAATTAAGTGTATGAAGGAGGGTTCTGCTACAACTTGGGATGATGTTGTCTTCATCCCTCCTGGTTTTGATGTTTCAACTACTCCTGCCAAGCAATAG
AA sequence
>Potri.002G236000.4 pacid=42777125 polypeptide=Potri.002G236000.4.p locus=Potri.002G236000 ID=Potri.002G236000.4.v4.1 annot-version=v4.1
MNFLPKSNDQQIFPASKQSPQIDLHHAFTTLQDHCSTFLQNLSHQFPLFNPNFQTHAKQSLDTLISRLNPNSPLSSKNPLWARIPHEPVIQPGTSMSTET
IEERLAGVPVYALSNSNEEFVLVSGLSTGKSLGLFCFKQEDAEALLEQMKSMDPGMRKGGSKVVPVALNKVFQLKVDGVAFRLIPEPSQVKNALMERERA
GLSDDCFSGVPVFQSRSLVLKSQNRSYRPVFFRKEDLEKSLLRASREQHKVNPAFKQGDIEVAVFEEIIKCMKEGSATTWDDVVFIPPGFDVSTTPAKQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G23710 AtTic22-III translocon at the inner envelo... Potri.002G236000 0 1
AT1G78930 Mitochondrial transcription te... Potri.007G001800 1.00 0.9494
AT4G26500 SUFE1, EMB1374,... SULFUR E 1, MBRYO DEFECTIVE 13... Potri.011G165400 2.44 0.9327
AT5G17710 EMB1241 embryo defective 1241, Co-chap... Potri.013G067900 3.16 0.9352
AT4G20010 PTAC9, OSB2 ORGANELLAR SINGLE-STRANDED DNA... Potri.001G394200 7.74 0.9298
AT2G38730 Cyclophilin-like peptidyl-prol... Potri.001G030000 8.30 0.8891
AT4G20020 unknown protein Potri.003G015100 8.36 0.9119
AT1G30680 toprim domain-containing prote... Potri.001G461300 11.66 0.8959
AT4G14540 CCAAT NF-YB3 "nuclear factor Y, subunit B3"... Potri.014G167800 12.64 0.8823
AT3G27550 RNA-binding CRS1 / YhbY (CRM) ... Potri.001G343700 12.96 0.8883
AT2G20710 Tetratricopeptide repeat (TPR)... Potri.016G063400 13.07 0.9025

Potri.002G236000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.