Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-XTR7.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23730 436 / 9e-156 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 435 / 3e-155 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT5G57560 371 / 2e-130 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT4G25810 371 / 4e-130 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57550 370 / 6e-130 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30270 365 / 6e-128 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G57530 360 / 1e-125 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57540 357 / 2e-124 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G48070 352 / 1e-122 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT2G18800 349 / 3e-121 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G146100 [exp] 524 / 0 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G060500 [exp] 451 / 9e-162 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 438 / 1e-156 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 436 / 8e-156 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 422 / 3e-150 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.011G077320 [exp] 416 / 7e-148 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 405 / 1e-142 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 392 / 1e-138 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 391 / 5e-138 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028947 [exp] 430 / 1e-153 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10000678 [exp] 422 / 2e-150 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10004723 [exp] 419 / 6e-149 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 418 / 2e-148 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10021638 [exp] 415 / 2e-147 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 400 / 9e-142 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 399 / 3e-141 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031393 [exp] 398 / 1e-140 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 395 / 1e-139 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020773 [exp] 394 / 3e-139 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.002G236200.1 pacid=42777980 polypeptide=Potri.002G236200.1.p locus=Potri.002G236200 ID=Potri.002G236200.1.v4.1 annot-version=v4.1 ATGGGGCTGTTCTGCAATGGATTCTCTCTGTTTCTGATAGTTTGCTCCATGGTGGTGGTTGCTTCTGGTAGTTTCTATCAGGATTTTGACTTGACATGGG GCGACCACCGTGCAAAGATATTCAACGGAGGACAGCTCCTCTCCCTGTCTCTAGACAAGGTTTCTGGGTCTGGATTCCAGTCCAAGAAGGAATACTTGTT TGGGAGGATTGATATGCAGCTCAAACTTGTTGCCGGCAACTCTGCTGGCACTGTAACAGCCTACTACTTGTCTTCTCAAGGAGCAACACATGACGAGATC GACTTCGAGTTCTTGGGGAACCTCAGCGGCGACCCTTACATTTTGCACACTAATGTGTTCACTCAGGGGAAGGGAAACAGAGAGCAGCAATTCTATCTCT GGTTTGACCCCACAAGAAACTTCCACACTTACTCCATCATCTGGAGCCAACAACACATCATTTTCTTGGTGGATAATTTTCCCATAAGGGTGTTCAAGAA TGCCGAATCAATTGGAGTTCCTTTCCCCAAGAGCCAGCCCATGAGGATTTACTCCAGCCTCTGGAACGCCGATGACTGGGCTACAAGAGGCGGGTTGGTG AAGACGGACTGGACGAAGGCACCCTTTACAGCTTACTACAGAAACTTCAAAGCTGATGCCTGTACTTGGTCCTATGGCACTTCTTCCTGTGGTTCCAGGT CTTCCAGTTCTTTCTCTGATCGTGCATGGCATACCAACGCCCTCGATGCTCCAAGCAGAAGAAGACTGAGATGGGTCCAGAAATACTTCATGATTTACAA CTACTGCGCTGACCTAAAACGCTTCCCTCAAGGTCTCCCTCCTGAGTGCAGACGCTCAAGATTCTGA
AA sequence Show only first row Show all	>Potri.002G236200.1 pacid=42777980 polypeptide=Potri.002G236200.1.p locus=Potri.002G236200 ID=Potri.002G236200.1.v4.1 annot-version=v4.1 MGLFCNGFSLFLIVCSMVVVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGATHDEI DFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPKSQPMRIYSSLWNADDWATRGGLV KTDWTKAPFTAYYRNFKADACTWSYGTSSCGSRSSSSFSDRAWHTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Potri.002G236200 [exp]	0	1	Pt-XTR7.2
AT1G46480	HD	WOX4	WUSCHEL related homeobox 4 (.1...		Potri.002G124100 [exp]	1.00	0.9183
AT3G11470			4'-phosphopantetheinyl transfe...		Potri.016G078400 [exp]	2.00	0.9143
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Potri.019G125000 [exp]	2.44	0.8937	Pt-XTH9.1
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Potri.001G239500 [exp]	2.64	0.8672
AT5G22930			Protein of unknown function (D...		Potri.010G229200 [exp]	2.82	0.8886
AT2G01950		VH1, BRL2	VASCULAR HIGHWAY 1, BRI1-like ...		Potri.008G140500 [exp]	7.74	0.8447
AT1G53440			Leucine-rich repeat transmembr...		Potri.011G072766 [exp]	10.67	0.8194
AT5G04700			Ankyrin repeat family protein ...		Potri.008G023700 [exp]	11.66	0.8474
AT5G22300		AtNIT4, NIT4	nitrilase 4 (.1)		Potri.006G207700 [exp]	13.49	0.8522
AT1G45688			unknown protein		Potri.002G124600 [exp]	18.33	0.8238

Compare expression of checked genes

Potri.002G236200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.