Potri.002G237000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31410 199 / 3e-65 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G145600 264 / 6e-91 AT2G31410 169 / 3e-53 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035165 200 / 1e-65 AT2G31410 196 / 3e-64 unknown protein
Lus10031995 199 / 4e-65 AT2G31410 194 / 3e-63 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03879 Cgr1 Cgr1 family
Representative CDS sequence
>Potri.002G237000.1 pacid=42778877 polypeptide=Potri.002G237000.1.p locus=Potri.002G237000 ID=Potri.002G237000.1.v4.1 annot-version=v4.1
ATGGCTTGCACGATAGACTTACGCTTCCTTGACGAAGGCTTCGGCGGCAAGACCTACAAGCGTAAACGCGAACATGAAGCGCTTCAACTAATCACCACCG
AAACCACAACCGCCGATGCATCGATGGAGATCGACGCACCACCGGCAAAGCGATCGGCAATACCTTCAACGGATAATCCAGACAAACCGGTAGCCGTGGG
AAAGCCAACATACGATGGGGTCATCGCAGGGAAGGTGTCTGGACGGAACTGGAAGCAACCGAGGAAACAGAGAGCGTCGGCGAAGCAAGTGAGCAAGAGG
GGCACGAATTTCGAGGAGAGGCAGAAGGAGAAGGAGATAAAGAAAGCATACAGAGAGAGGAAGAATGAGTTGAAGGAGGAGATTAGGAAGAATAAGGTGG
AGAAGAGGAAGATGAGAGAAGAAAGAGAGAAGAGGAAGCAGGAGAATATATTGAGGTCTGGTACTAAGTTGCAGAAGATCACTAACCCTAAAACTCTCAA
GAAGATTGCTAAGTCTAAGGATAGGAAGATGCTTAAGGTTGTGCCTGATGAGCTTGTTAACAACAACAAGAAGAAGAATGCTAACAAGAAGGATTAG
AA sequence
>Potri.002G237000.1 pacid=42778877 polypeptide=Potri.002G237000.1.p locus=Potri.002G237000 ID=Potri.002G237000.1.v4.1 annot-version=v4.1
MACTIDLRFLDEGFGGKTYKRKREHEALQLITTETTTADASMEIDAPPAKRSAIPSTDNPDKPVAVGKPTYDGVIAGKVSGRNWKQPRKQRASAKQVSKR
GTNFEERQKEKEIKKAYRERKNELKEEIRKNKVEKRKMREEREKRKQENILRSGTKLQKITNPKTLKKIAKSKDRKMLKVVPDELVNNNKKKNANKKD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G31410 unknown protein Potri.002G237000 0 1
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Potri.014G068000 114.86 0.4954
AT1G23880 NHL domain-containing protein ... Potri.008G122450 131.80 0.4686
AT4G30390 unknown protein Potri.019G051850 169.42 0.4535
Potri.010G201801 181.10 0.4683

Potri.002G237000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.