Potri.002G239000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07480 236 / 5e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G177100 280 / 2e-98 AT3G07480 239 / 2e-82 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G182100 42 / 5e-05 AT4G21090 260 / 2e-89 ARABIDOPSIS MITOCHONDRIAL FERREDOXIN 2, MITOCHONDRIAL FERREDOXIN 2 (.1.2.3)
Potri.001G044700 40 / 0.0003 AT4G21090 259 / 6e-89 ARABIDOPSIS MITOCHONDRIAL FERREDOXIN 2, MITOCHONDRIAL FERREDOXIN 2 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020390 244 / 4e-84 AT3G07480 238 / 2e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10009565 244 / 6e-84 AT3G07480 236 / 6e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10009568 244 / 6e-84 AT3G07480 236 / 6e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.002G239000.1 pacid=42777903 polypeptide=Potri.002G239000.1.p locus=Potri.002G239000 ID=Potri.002G239000.1.v4.1 annot-version=v4.1
ATGGCAACATCATCTCTACACAGACTCTCCTCTCAAATCAACCGCATTCCTTCTCTCTCTCCCTTCACCAAATCCATCCTCACCCGCTCCTCCGCCACCA
CCACCTCCGCCGCCAAAGTCGCCGATAGAATCGTGAAGCTCTCAGCGATCGATCCGGACGGCCAGAAGCGAGAGATCGTGGGTCTTTCAGGTCATACTCT
CCTCAAAGCCCTAACAAATAACGGCCTAATCGACCCAGCCTCGCATCGCCTGGAGGAGATCGAGGCTTGCTCCGCTGAATGCGAGGTCAACATCGCCCAG
GAGTGGCTCGAGAAGCTGCCCCCGAGATCTTATGACGAGGAATATGTGCTGAAGAGGAATTCGAGAGCTAGGGTTTTGAACAAGCATTCAAGGTTGGGTT
GTCAGGTTGTGCTTACCAAGGATCTCCAAGGTATGGTTGTTGCTGTCCCTGAGCCTAAGCCTTGGGATATTCCATAA
AA sequence
>Potri.002G239000.1 pacid=42777903 polypeptide=Potri.002G239000.1.p locus=Potri.002G239000 ID=Potri.002G239000.1.v4.1 annot-version=v4.1
MATSSLHRLSSQINRIPSLSPFTKSILTRSSATTTSAAKVADRIVKLSAIDPDGQKREIVGLSGHTLLKALTNNGLIDPASHRLEEIEACSAECEVNIAQ
EWLEKLPPRSYDEEYVLKRNSRARVLNKHSRLGCQVVLTKDLQGMVVAVPEPKPWDIP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07480 2Fe-2S ferredoxin-like superfa... Potri.002G239000 0 1
AT5G47030 ATPase, F1 complex, delta/epsi... Potri.003G086100 6.78 0.9096
AT2G20820 unknown protein Potri.019G109100 7.54 0.8931
AT1G64160 Disease resistance-responsive ... Potri.001G096680 8.66 0.8582
AT1G64160 Disease resistance-responsive ... Potri.013G142501 8.94 0.8577
AT1G64160 Disease resistance-responsive ... Potri.013G142602 9.21 0.8577
AT1G64160 Disease resistance-responsive ... Potri.001G096800 10.95 0.8548 Pt-DRR206.2
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Potri.001G171200 20.97 0.8826
AT1G19580 GAMMACA1 ,GAMMA... gamma carbonic anhydrase 1 (.1... Potri.002G034100 23.83 0.8892 APFI.1
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Potri.001G383500 24.89 0.8440
AT2G43310 Ribosomal L18p/L5e family prot... Potri.007G128100 27.23 0.8587

Potri.002G239000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.