Potri.002G239451 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G239451.1 pacid=42776970 polypeptide=Potri.002G239451.1.p locus=Potri.002G239451 ID=Potri.002G239451.1.v4.1 annot-version=v4.1
ATGAGACCGATATCCCACCTACTTTTACCATTTGAGACACATCTATGGAGCAGAGTCAAATGTGAACTCAAAAATCCTGAAAAAGATCTTGATTCTTTTT
TCAGTACTCTTGCCAAGAGACTGAGGGAGAATCTGATGCAATCTCTCCATGCATATCCCTGCCAATGCCCTCGCAGAGTACCACCGGGCAAGCCATAG
AA sequence
>Potri.002G239451.1 pacid=42776970 polypeptide=Potri.002G239451.1.p locus=Potri.002G239451 ID=Potri.002G239451.1.v4.1 annot-version=v4.1
MRPISHLLLPFETHLWSRVKCELKNPEKDLDSFFSTLAKRLRENLMQSLHAYPCQCPRRVPPGKP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G239451 0 1
Potri.003G026106 1.00 0.9155
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.007G050000 3.16 0.9002
AT4G13460 SET22, SDG22, S... SETDOMAIN GROUP 22, SU(VAR)3-9... Potri.010G064300 5.56 0.8350
AT3G55550 Concanavalin A-like lectin pro... Potri.010G200600 6.48 0.8159
Potri.001G282604 9.48 0.8831
Potri.010G159650 10.95 0.8594
AT3G01490 Protein kinase superfamily pro... Potri.017G072900 11.61 0.8111
AT1G15190 Fasciclin-like arabinogalactan... Potri.001G306800 12.48 0.8629
Potri.005G144750 12.64 0.8549
Potri.010G076150 14.24 0.8407

Potri.002G239451 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.