Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07090 367 / 8e-129 PPPDE putative thiol peptidase family protein (.1) AT5G25170 64 / 4e-12 PPPDE putative thiol peptidase family protein (.1) AT4G17486 64 / 6e-12 PPPDE putative thiol peptidase family protein (.1.2) AT2G25190 62 / 3e-11 PPPDE putative thiol peptidase family protein (.1) AT4G25680 61 / 8e-11 PPPDE putative thiol peptidase family protein (.1) AT1G47740 61 / 1e-10 PPPDE putative thiol peptidase family protein (.1.2) AT4G31980 61 / 2e-10 unknown protein AT5G47310 59 / 3e-10 PPPDE putative thiol peptidase family protein (.1) AT4G25660 58 / 1e-09 PPPDE putative thiol peptidase family protein (.1) AT1G80690 55 / 1e-08 PPPDE putative thiol peptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G154400 [exp] 70 / 4e-14 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2) Potri.001G154400 [exp] 66 / 1e-12 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1) Potri.018G070600 [exp] 65 / 3e-12 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2) Potri.006G261500 [exp] 65 / 3e-12 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1) Potri.003G080300 [exp] 65 / 3e-12 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1) Potri.002G134200 [exp] 64 / 1e-11 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2) Potri.T126004 [exp] 63 / 1e-11 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.009G113168 [exp] 63 / 2e-11 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.018G021700 [exp] 61 / 1e-10 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038168 [exp] 386 / 2e-136 AT3G07090 369 / 3e-130 PPPDE putative thiol peptidase family protein (.1) Lus10025931 [exp] 320 / 6e-111 AT3G07090 311 / 1e-107 PPPDE putative thiol peptidase family protein (.1) Lus10043293 [exp] 75 / 1e-15 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2) Lus10019437 [exp] 72 / 2e-14 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2) Lus10013657 [exp] 69 / 1e-13 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2) Lus10005341 [exp] 66 / 9e-13 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1) Lus10018326 [exp] 66 / 1e-12 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1) Lus10041021 [exp] 65 / 3e-12 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1) Lus10017127 [exp] 64 / 6e-12 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1) Lus10027510 [exp] 64 / 2e-11 AT4G25680 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF05903 [poplar] [flax] Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence Show only first row Show all	>Potri.002G241700.3 pacid=42780206 polypeptide=Potri.002G241700.3.p locus=Potri.002G241700 ID=Potri.002G241700.3.v4.1 annot-version=v4.1 ATGGCTGAGGAGGGTTACAAGGTTACTTTGAATGTGTATGATCTCAGCCAAGGATTGGCACGGCAACTCTCGACAGCGTTTTTGGGGAAGGCCATTGATG GAATCTGGCACACAGGAGTTGTGGTGTACGGTAATGAATACTTCTTTGGGGGAGGTATACAACATTTGCCTTCTGGAACAACTCCATATGGAACGCCAAT TAAAGTGGTTGATTTGGGTATCACACATGTACCCCAGGATGTATTTGAAGAGTATCTGCAGGAAATTAGTTCCCGTTACTCTGCTGAGACTTATAGTTTA CTTACTCACAACTGCAACAACTTCAGCAATGAGGTTGCCCAGTTTTTGGTGGGTGTGACCATTCCAGAATATATTATTCAGCTACCCAATGAAGTCATGA ACAGTCCAATGGGTGCTCTTATAATGCCCATGATACAAAATCTGGAGTCAACACTGAGAGCAGGGGCTGTCCCGCAAGTTCCACAATTCAGGCCTCCTTC AATGGCGCAGTCTTCACAGGCTGCAACAGTTACTGTTGATAAATCCACGGCCAGTGGTCCTAGCCCTTCCACAAAAGTAATCGTTAAAGAGGCTGATGTC AAAGTCAAATCTGTTGATACCAAACCAAACAAAACATCGGGCACAGTCAAATCTGCAGAAGCCAAGGGGAAGACTACAGTCAATGGAGGAGATCCTCTTG GGGATGCACGAAACAAAGTACAGGAGGAGATCGGCCGCGAATTCGCTGCGATCATGGCTACCGGCACATTTCGTGCAAGCGAGGCAGCAGCTTTAGCTAC CAAGAGAGTAATGCAAAGATATGGTCATCTAAATGCTGCAATGCCACAAAGCTAG
AA sequence Show only first row Show all	>Potri.002G241700.3 pacid=42780206 polypeptide=Potri.002G241700.3.p locus=Potri.002G241700 ID=Potri.002G241700.3.v4.1 annot-version=v4.1 MAEEGYKVTLNVYDLSQGLARQLSTAFLGKAIDGIWHTGVVVYGNEYFFGGGIQHLPSGTTPYGTPIKVVDLGITHVPQDVFEEYLQEISSRYSAETYSL LTHNCNNFSNEVAQFLVGVTIPEYIIQLPNEVMNSPMGALIMPMIQNLESTLRAGAVPQVPQFRPPSMAQSSQAATVTVDKSTASGPSPSTKVIVKEADV KVKSVDTKPNKTSGTVKSAEAKGKTTVNGGDPLGDARNKVQEEIGREFAAIMATGTFRASEAAALATKRVMQRYGHLNAAMPQS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G07090			PPPDE putative thiol peptidase...		Potri.002G241700 [exp]	0	1
AT5G37670		HSP15.7CI	HSP20-like chaperones superfam...		Potri.017G130700 [exp]	2.44	0.9870
AT2G32120		HSP70T-2	heat-shock protein 70T-2 (.1.2...		Potri.010G088600 [exp]	2.44	0.9889
AT3G09350		Fes1A	Fes1A (.1.2.3)		Potri.006G088000 [exp]	2.64	0.9841
AT4G25200		ATHSP23.6-MITO	mitochondrion-localized small ...		Potri.003G076000 [exp]	3.74	0.9872
AT3G08970		TMS1, ATERDJ3A	THERMOSENSITIVE MALE STERILE 1...		Potri.016G120000 [exp]	4.89	0.9844
AT2G45380			unknown protein		Potri.014G069100 [exp]	4.89	0.9781
AT1G03070			Bax inhibitor-1 family protein...		Potri.002G049000 [exp]	5.19	0.9821
AT1G53540			HSP20-like chaperones superfam...		Potri.001G238700 [exp]	5.29	0.9861	Pt-HSP17.13
AT1G66080			unknown protein		Potri.004G082100 [exp]	5.65	0.9523
AT1G52560			HSP20-like chaperones superfam...		Potri.001G192600 [exp]	5.91	0.9854

Compare expression of checked genes

Potri.002G241700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.