Pt-RPL13.3 (Potri.002G242600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPL13.3
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13170 357 / 3e-127 Ribosomal protein L13 family protein (.1)
AT5G48760 356 / 8e-127 Ribosomal protein L13 family protein (.1.2)
AT3G24830 353 / 6e-126 Ribosomal protein L13 family protein (.1)
AT3G07110 350 / 1e-124 Ribosomal protein L13 family protein (.1.2)
AT1G78630 56 / 3e-09 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G314500 359 / 3e-128 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.017G054600 355 / 1e-126 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.001G384600 50 / 2e-07 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 49 / 3e-07 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011857 362 / 3e-129 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 361 / 6e-129 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
Lus10016679 358 / 1e-127 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10007137 355 / 2e-126 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10043151 352 / 5e-125 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10032599 352 / 5e-125 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10005553 47 / 4e-06 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Potri.002G242600.1 pacid=42777323 polypeptide=Potri.002G242600.1.p locus=Potri.002G242600 ID=Potri.002G242600.1.v4.1 annot-version=v4.1
ATGGTGTCAGGATCAGGTGTCTGCGCGAAGGTGGTAGTGGTGGACGCGAGACACCACATGCTTGGGCGTTTGGCATCTATCATTGCTAAGGAGCTCTTGA
ACGGCCAGAAAGTTGTGGTTGTTAGGTGCGAGGAGATATGTATGTCTGGTGGGCTTGTGAGACAGAAGATGAAGTACTTGAGGTTTCTCCGTAAGCGCAT
GAACACCAAGCCTTCTCATGGTCCCATCCACTTCCGCGCTCCTGCTAAGATCTTCTGGCGCACCGTTCGTGGAATGATACCACACAAGACTAAGAAAGGG
GAGGCAGCACTTGCAAGGTTGAAGGCTTATGAGGGAATCCCACCTCCTTATGACAAGAAGAAGAGGATGGTTATCCCTGATGCTCTTAAGGTGTTGAGGC
TTCAGAAGGGTCACAAGTACTGCTTGTTGGGCAAACTGTCATCTGAGGTTGGATGGAACCACTATGACATCATCAGGGAGCTGGAGGAGAAGAGGAAGGA
GAGGTCCCAGGTTAGATATGAAAGGAAGAAACAGCTCAACAAACTCAGGGCAAAGGCAGAGGTAACTGCAGAAGAAAAACTTGGTCCCCAAGTAGATATC
CTTGCACCTGTTAAGTACTGA
AA sequence
>Potri.002G242600.1 pacid=42777323 polypeptide=Potri.002G242600.1.p locus=Potri.002G242600 ID=Potri.002G242600.1.v4.1 annot-version=v4.1
MVSGSGVCAKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKG
EAALARLKAYEGIPPPYDKKKRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDIIRELEEKRKERSQVRYERKKQLNKLRAKAEVTAEEKLGPQVDI
LAPVKY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G13170 Ribosomal protein L13 family p... Potri.002G242600 0 1 Pt-RPL13.3
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.013G013600 1.00 0.9741 RPL18.11
AT1G74050 Ribosomal protein L6 family pr... Potri.009G065800 2.44 0.9716
AT2G37190 Ribosomal protein L11 family p... Potri.006G077200 2.44 0.9711 RPL12.4
AT4G16720 Ribosomal protein L23/L15e fam... Potri.001G156100 7.74 0.9653 RPL15.3
AT5G58420 Ribosomal protein S4 (RPS4A) f... Potri.016G124100 7.93 0.9483
AT5G59850 Ribosomal protein S8 family pr... Potri.003G114800 7.93 0.9637 RPS15.1
AT5G28060 Ribosomal protein S24e family ... Potri.010G087800 8.24 0.9495
AT5G04800 Ribosomal S17 family protein (... Potri.010G241200 9.79 0.9639
AT3G02560 Ribosomal protein S7e family p... Potri.004G099200 10.00 0.9643
AT5G15610 Proteasome component (PCI) dom... Potri.004G116700 11.53 0.9490

Potri.002G242600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.