Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-XTH2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13090 322 / 9e-111 XTH2 xyloglucan endotransglucosylase/hydrolase 2 (.1) AT4G13080 310 / 8e-106 XTH1 xyloglucan endotransglucosylase/hydrolase 1 (.1) AT3G25050 297 / 6e-101 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1) AT5G13870 257 / 3e-85 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) AT2G06850 257 / 5e-85 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1) AT5G65730 239 / 4e-78 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1) AT4G37800 236 / 6e-77 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1) AT2G14620 234 / 7e-76 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1) AT3G23730 219 / 3e-70 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G57550 216 / 3e-69 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G140300 [exp] 259 / 7e-86 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.001G071000 [exp] 253 / 2e-83 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.003G159700 [exp] 251 / 7e-83 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.007G008500 [exp] 246 / 1e-80 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1) Potri.011G077320 [exp] 231 / 9e-75 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G152400 [exp] 228 / 1e-73 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.009G083800 [exp] 226 / 8e-73 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1) Potri.005G201200 [exp] 223 / 8e-72 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060500 [exp] 223 / 1e-71 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025919 [exp] 298 / 4e-101 AT4G13090 318 / 4e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1) Lus10038182 [exp] 295 / 8e-100 AT4G13090 319 / 2e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1) Lus10011052 [exp] 260 / 7e-86 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10003022 [exp] 259 / 1e-85 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10011597 [exp] 253 / 2e-83 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10039643 [exp] 251 / 1e-82 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10040121 [exp] 243 / 1e-79 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10032879 [exp] 243 / 3e-79 AT4G13090 248 / 2e-81 xyloglucan endotransglucosylase/hydrolase 2 (.1) Lus10030923 [exp] 239 / 3e-78 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10010938 [exp] 232 / 3e-75 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.002G244200.1 pacid=42778247 polypeptide=Potri.002G244200.1.p locus=Potri.002G244200 ID=Potri.002G244200.1.v4.1 annot-version=v4.1 ATGAATTGCAGAATTCTAGCTACAATGGATTTTTGTCTCCCTTGTTTCCTTGCATTTCTCCTCATGGGAGGGGTGCTTGCAAGGAGAAATGGAGGCGATG CTAGCTTTGATCAGAATTATGATATCACTTGGGGATATGATCATGTCAAATCCCTTGATGAAGGAAGACAGATTCAGCTCTCGTTAGATCATTCTTCTGG TTCTGGATTTGGTTCCAAGCTAGGATTTGGTTCAGGATTCATTAACATGAGGATAAAGCTACCAGGAAAGGATTCTGCAGGAGTTGTCACGGCATTCTAT CTAACTTCACACAGTAACAATCACGATGAGCTCGACTTTGAGTTCCTGGGCAACAGGGAAGAGAAGCCTATCACACTACAGACAAATGTGTTTGCAAATG GTCGAGGGAATAGAGAGCAAAGGATGCATCTTTGGTTCGACCCAGCTGCTGACTTCCACTCTTACAAAATCTTGTGGAACCAATATCAGATTGTATTTTA TGTGGATGATACTCCCATAAGAGTGTTCAAGAACCACACGAATATTGGAGTCAGCTACCCTTCACAGCCAATGCAAATAGAGGCAAGCTTGTGGAATGGA GAAAGCTGGGCAACAGACGGAGGCCATACAAAGATTAATTGGAGCCATGCACCATTTCAAGCTCATTTCCAAGGATTTGACATTAATGGCTGCTCAGATC ATCAACGACAACCAAACGTTCAGCCATGTTATTCGACCAGCTACTGGTGGAATACCCGAAAGTACTGGACACTGGACTCTGCCCGACAAAGGGCATATGA GAATGTCAGGAAGAAGTATTTGACTTATGACTATTGTTCTGATAGGCCCAGGTACCCTACACCTCCCCCAGAGTGCCCTCAATAA
AA sequence Show only first row Show all	>Potri.002G244200.1 pacid=42778247 polypeptide=Potri.002G244200.1.p locus=Potri.002G244200 ID=Potri.002G244200.1.v4.1 annot-version=v4.1 MNCRILATMDFCLPCFLAFLLMGGVLARRNGGDASFDQNYDITWGYDHVKSLDEGRQIQLSLDHSSGSGFGSKLGFGSGFINMRIKLPGKDSAGVVTAFY LTSHSNNHDELDFEFLGNREEKPITLQTNVFANGRGNREQRMHLWFDPAADFHSYKILWNQYQIVFYVDDTPIRVFKNHTNIGVSYPSQPMQIEASLWNG ESWATDGGHTKINWSHAPFQAHFQGFDINGCSDHQRQPNVQPCYSTSYWWNTRKYWTLDSARQRAYENVRKKYLTYDYCSDRPRYPTPPPECPQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	0	1	Pt-XTH2.1
AT5G53540			P-loop containing nucleoside t...		Potri.012G022985 [exp]	5.09	0.9027
AT1G55290			2-oxoglutarate (2OG) and Fe(II...		Potri.001G007100 [exp]	7.21	0.8675
					Potri.018G003650 [exp]	14.66	0.8883
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Potri.013G012666 [exp]	15.87	0.8751
AT4G32680			unknown protein		Potri.006G244600 [exp]	19.97	0.8350
AT3G55646			unknown protein		Potri.008G061700 [exp]	20.97	0.8897
AT5G07440		GDH2	glutamate dehydrogenase 2 (.1....		Potri.015G111000 [exp]	21.16	0.8650
AT1G24400		ATLHT2, AATL2, ...	ARABIDOPSIS LYSINE HISTIDINE T...		Potri.008G179000 [exp]	21.44	0.8315
AT3G56180			Protein of unknown function (D...		Potri.008G075100 [exp]	22.27	0.8526
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Potri.001G376200 [exp]	22.97	0.8753

Compare expression of checked genes

Potri.002G244200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.