Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07170 213 / 1e-70 Sterile alpha motif (SAM) domain-containing protein (.1) AT5G48680 157 / 2e-48 Sterile alpha motif (SAM) domain-containing protein (.1) AT1G70180 76 / 7e-16 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) AT2G45700 47 / 3e-06 sterile alpha motif (SAM) domain-containing protein (.1) AT3G48800 43 / 8e-05 Sterile alpha motif (SAM) domain-containing protein (.1) AT5G23680 42 / 9e-05 Sterile alpha motif (SAM) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G190800 [exp] 304 / 1e-106 AT3G07170 218 / 1e-72 Sterile alpha motif (SAM) domain-containing protein (.1) Potri.008G193300 [exp] 87 / 4e-20 AT1G70180 122 / 3e-31 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) Potri.010G036500 [exp] 85 / 1e-19 AT1G70180 134 / 1e-35 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) Potri.006G218300 [exp] 45 / 1e-05 AT2G45700 732 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1) Potri.012G104700 [exp] 43 / 6e-05 AT3G48800 166 / 2e-49 Sterile alpha motif (SAM) domain-containing protein (.1) Potri.015G104000 [exp] 42 / 0.0001 AT3G48800 115 / 5e-30 Sterile alpha motif (SAM) domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038185 [exp] 266 / 3e-91 AT3G07170 234 / 9e-79 Sterile alpha motif (SAM) domain-containing protein (.1) Lus10022780 [exp] 265 / 7e-91 AT3G07170 219 / 5e-73 Sterile alpha motif (SAM) domain-containing protein (.1) Lus10011841 [exp] 241 / 3e-78 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1) Lus10025917 [exp] 166 / 2e-52 AT3G07170 157 / 3e-49 Sterile alpha motif (SAM) domain-containing protein (.1) Lus10014516 [exp] 82 / 1e-18 AT1G70180 80 / 1e-16 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) Lus10030825 [exp] 66 / 1e-12 AT1G70180 104 / 8e-25 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) Lus10030661 [exp] 64 / 4e-12 AT1G70180 102 / 6e-24 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2) Lus10038078 [exp] 47 / 4e-06 AT2G45700 767 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0003 [poplar] [flax] SAM PF00536 [poplar] [flax] SAM_1 SAM domain (Sterile alpha motif)
Representative CDS sequence Show only first row Show all	>Potri.002G244700.1 pacid=42776940 polypeptide=Potri.002G244700.1.p locus=Potri.002G244700 ID=Potri.002G244700.1.v4.1 annot-version=v4.1 ATGTATGCTGATCGCGTAGACGCTGCAGCGAAGACTTCAATAAAGGATCGCCTTAACGGCAATTCCATCGGCGACTCCGCTCGCCTCCGTCATATTACTG GCAAAAGGCAGAGGCAAGATGATAAATGGGAACATGATCTCTATGATGATGGTGGACCACGTGTTTCAAATCACAAAATTGATGCTCGAGATCTTCGGTT AAAGCTCCAAAGGAAAAGTTTCCAGCAAGCGTCTCCCCGTTCAGGTGTGCGGGATCTGCGTGAAAAACTATCGGGGACGATGAATTCACAGCCAGCAAAT GTTGATCCACCCAAACCAAAAATAGCTGTTGCTAAACCAGCCAGGAGAAGTGTTGCTGTTGAAGCTCCTGAACCAGAGATTAAAAAAACTGCCAATGTGG TTTCTAGAAAAGGATATCAGCAGAAGACGGATTCATCTGTGGATGGCTTTTTGCAGTCATTGGGTCTTGAGAAATATCTCATTACTTTTCAAGCTGAGGA GGTGGATATGACAGCTCTTGTACACATGAATGATGAAGACTTGAAGGCTTTAGGGATACCAATGGGCCCAAGGAAGAAAATACTCTTAGCGTTAGAATCA AGGGGCTGA
AA sequence Show only first row Show all	>Potri.002G244700.1 pacid=42776940 polypeptide=Potri.002G244700.1.p locus=Potri.002G244700 ID=Potri.002G244700.1.v4.1 annot-version=v4.1 MYADRVDAAAKTSIKDRLNGNSIGDSARLRHITGKRQRQDDKWEHDLYDDGGPRVSNHKIDARDLRLKLQRKSFQQASPRSGVRDLREKLSGTMNSQPAN VDPPKPKIAVAKPARRSVAVEAPEPEIKKTANVVSRKGYQQKTDSSVDGFLQSLGLEKYLITFQAEEVDMTALVHMNDEDLKALGIPMGPRKKILLALES RG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G07170			Sterile alpha motif (SAM) doma...		Potri.002G244700 [exp]	0	1
AT3G18940			clast3-related (.1)		Potri.004G148500 [exp]	1.00	0.8441
AT5G11900			Translation initiation factor ...		Potri.006G228100 [exp]	1.73	0.7910
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Potri.002G205700 [exp]	3.16	0.7849	Pt-GRP2.1
AT5G37055		ATSWC6, SEF	SERRATED LEAVES AND EARLY FLOW...		Potri.013G152600 [exp]	5.29	0.7865
AT4G28440			Nucleic acid-binding, OB-fold-...		Potri.007G137600 [exp]	7.61	0.8118
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Potri.001G269500 [exp]	7.74	0.7258
AT4G27040		VPS22	EAP30/Vps36 family protein (.1...		Potri.001G424600 [exp]	9.16	0.7096
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.004G226600 [exp]	9.48	0.7190
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Potri.001G347700 [exp]	10.48	0.7469	PtrcGrx_C2
AT3G12290			Amino acid dehydrogenase famil...		Potri.011G098600 [exp]	12.00	0.7559

Compare expression of checked genes

Potri.002G244700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.