Plant FIBer expression Database

Potri.002G246300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07230 76 / 5e-21 wound-responsive protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G191300
[exp]
89 / 9e-26 AT3G07230 44 / 8e-08 wound-responsive protein-related (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08186 Wound_ind Wound-inducible basic protein family
Representative CDS sequence
>Potri.002G246300.2 pacid=42777933 polypeptide=Potri.002G246300.2.p locus=Potri.002G246300 ID=Potri.002G246300.2.v4.1 annot-version=v4.1
ATGATCTACGACGTCAACTCTCCTCTCTTTCGCTCATTCCTCAGCCAGAAGGGTGGCTCTTCCGATAAGAGGAAAATGGAGGAGCAGAAGCCAAAGGAAC
AGAGACCCAAAGCTAACGAGAACAAGCCTGTTATGACAGAGTGA
AA sequence
>Potri.002G246300.2 pacid=42777933 polypeptide=Potri.002G246300.2.p locus=Potri.002G246300 ID=Potri.002G246300.2.v4.1 annot-version=v4.1
MIYDVNSPLFRSFLSQKGGSSDKRKMEEQKPKEQRPKANENKPVMTE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07230 wound-responsive protein-relat... Potri.002G246300
[exp]
0 1
AT1G27435 unknown protein Potri.001G325000
[exp]
2.23 0.8352
AT4G39200 Ribosomal protein S25 family p... Potri.004G157200
[exp]
6.55 0.8492
AT3G12587 Oligosaccaryltransferase (.1) Potri.008G053300
[exp]
7.74 0.8197
Potri.016G120333
[exp]
8.83 0.7969
AT4G31985 Ribosomal protein L39 family p... Potri.006G188500
[exp]
9.94 0.8320
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.001G295902
[exp]
12.00 0.8304
AT4G29830 VIP3 vernalization independence 3, ... Potri.006G145800
[exp]
13.26 0.8176
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Potri.002G190000
[exp]
13.85 0.8403
AT3G57490 Ribosomal protein S5 family pr... Potri.006G052400
[exp]
18.11 0.8452 Pt-RPS2.2
AT2G27970 CKS2 CDK-subunit 2 (.1) Potri.004G217500
[exp]
18.13 0.7921

Potri.002G246300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.