Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48580 228 / 1e-77 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 220 / 9e-75 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT3G25230 110 / 1e-28 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT5G48570 103 / 3e-26 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G45680 94 / 2e-24 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT4G39710 87 / 1e-21 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT4G25340 81 / 1e-18 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT3G55520 76 / 1e-17 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 74 / 2e-17 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 67 / 6e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149400 [exp] 110 / 1e-28 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 104 / 8e-27 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.001G075500 [exp] 92 / 8e-24 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.012G129200 [exp] 94 / 6e-23 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.006G033400 [exp] 91 / 6e-22 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 91 / 9e-22 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.005G079700 [exp] 80 / 6e-19 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.008G057900 [exp] 71 / 1e-15 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.010G201600 [exp] 69 / 6e-15 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002339 [exp] 253 / 1e-87 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1) Lus10003170 [exp] 249 / 3e-86 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10025889 [exp] 210 / 3e-71 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10038215 [exp] 214 / 7e-69 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035800 [exp] 137 / 2e-42 AT5G48580 127 / 1e-38 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10003171 [exp] 104 / 1e-26 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 104 / 2e-26 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 103 / 2e-26 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 102 / 6e-26 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10006949 [exp] 92 / 1e-23 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.002G248200.4 pacid=42779344 polypeptide=Potri.002G248200.4.p locus=Potri.002G248200 ID=Potri.002G248200.4.v4.1 annot-version=v4.1 ATGGGCTTCAACTGCGCATCCAAGGCGACCGCGATATTCCTTTTGCTATCAGTAACAGCGCTGGTTTCCGCTAAGAAGTCCGGCGATGTCAAGGAATTGC AGATCGGCGTGAAGTACAAGCCCGAAACTTGTGAAGTTCAGGCTCACAAGGGAGATAGCATCAAAGTACACTATCGAGGAAAACTCACCGATGGAACTGT TTTCGACTCCAGCTTTGAAAGGGGTGATCCTATTGGATTTGAGCTTGGCAGTGGTCAAGTTATCAAAGGATGGGACCAAGGACTGCTGGGAGCGTGTGTA GGTGAGAAGCGAAAATTGAAAATACCTGCAAAACTTGGTTATGGGGAGCAGGGATCCCCTCCTACTATTCCAGGTGGAGCGACACTAATATTTGACACTG AGCTTGTCGAAGTGAATGGGAAAACATCAAGTGGAGGGGGAGCTAGCGATAGTGAGCTTTAG
AA sequence Show only first row Show all	>Potri.002G248200.4 pacid=42779344 polypeptide=Potri.002G248200.4.p locus=Potri.002G248200 ID=Potri.002G248200.4.v4.1 annot-version=v4.1 MGFNCASKATAIFLLLSVTALVSAKKSGDVKELQIGVKYKPETCEVQAHKGDSIKVHYRGKLTDGTVFDSSFERGDPIGFELGSGQVIKGWDQGLLGACV GEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELVEVNGKTSSGGGASDSEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Potri.002G248200 [exp]	0	1
AT2G20820			unknown protein		Potri.013G146000 [exp]	1.00	0.9554
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Potri.003G096800 [exp]	2.00	0.9359	Pt-DAD1.1
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Potri.010G217800 [exp]	2.44	0.9479
AT5G61310			Cytochrome c oxidase subunit V...		Potri.002G195901 [exp]	4.35	0.9192
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Potri.001G171200 [exp]	4.47	0.9353
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Potri.006G059300 [exp]	5.19	0.9362
AT1G72020			unknown protein		Potri.019G081700 [exp]	6.92	0.9221
AT2G43640			Signal recognition particle, S...		Potri.013G125200 [exp]	7.48	0.9301
AT4G37830			cytochrome c oxidase-related (...		Potri.007G008800 [exp]	8.12	0.9329
AT1G27390		TOM20-2	translocase outer membrane 20-...		Potri.001G330200 [exp]	9.00	0.9294

Compare expression of checked genes

Potri.002G248200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.