AIR12.1 (Potri.002G249200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol AIR12.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07390 158 / 3e-47 AIR12 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
AT4G12980 144 / 9e-41 Auxin-responsive family protein (.1)
AT3G25290 138 / 2e-38 Auxin-responsive family protein (.1.2)
AT5G35735 101 / 8e-25 Auxin-responsive family protein (.1)
AT5G48750 97 / 6e-24 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G47530 98 / 2e-23 Auxin-responsive family protein (.1)
AT3G59070 96 / 2e-22 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT4G17280 91 / 8e-21 Auxin-responsive family protein (.1)
AT2G04850 67 / 2e-12 Auxin-responsive family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249300 148 / 2e-42 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.013G118300 106 / 2e-26 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
Potri.019G096300 105 / 2e-26 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.001G031600 105 / 3e-26 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Potri.019G095800 105 / 3e-26 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.019G096400 103 / 3e-25 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1)
Potri.010G156600 100 / 2e-24 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
Potri.016G010900 100 / 2e-24 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1)
Potri.006G015000 99 / 1e-23 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038224 223 / 7e-73 AT3G07390 182 / 7e-57 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Lus10025879 221 / 5e-72 AT3G07390 181 / 3e-56 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Lus10002274 97 / 5e-23 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10001734 96 / 1e-22 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10012350 91 / 1e-20 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10017564 87 / 2e-19 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10010498 86 / 4e-19 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
Lus10025878 79 / 1e-18 AT3G25290 88 / 8e-22 Auxin-responsive family protein (.1.2)
Lus10025877 75 / 1e-15 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10000915 60 / 5e-10 AT3G25290 205 / 2e-61 Auxin-responsive family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04526 DUF568 Protein of unknown function (DUF568)
Representative CDS sequence
>Potri.002G249200.1 pacid=42777861 polypeptide=Potri.002G249200.1.p locus=Potri.002G249200 ID=Potri.002G249200.1.v4.1 annot-version=v4.1
ATGGCCTCCCTTCCCTTTTCTGCCCTCTCTCTGTTTTTTTCCCTCTGTGTTCTGCTAGTCTTGCCCACGCATTCACTAACCTGCAGCACCTCACAAAAAT
TCACCAACAACAAGCATTACACTAACTGCACTGCCCTACCTGCCCTCAAGTCATACCTCCACTACACCTACAACTCCTCCAATTCCTCACTCTCAGTCGC
GTTCATCGCTTCTCCGGCCAAACCCGATGGCTGGACCGGTTGGGGCATCAACCTTAACGGCACCGGCATGGCTGGGGCCCAAGTCATTTTAGCTTTGAAA
TCCAGCAAAGGCGCACCAGAGGTAAAAACATACAATATCATATCATACGGTGACATCAGGGAGGAGAGACTGTCTTTCGATGTTTGGGACTTGAGTGCTG
AGACCAATGCAACAAGTGGTGAGTTTACCATCTATGCATCGGTTAAGTTGCCTGAAAAGGTTGAGTCTTTTAATCATATTTGGCAAGTGGGTGCTGCTGT
GAATAATGGGAAGCCTGTCAAGCATGAATTTGCAGCAGAAAACAAGGATGCTAAAGCAACTTTGGAGTTGACTACTGCTCAGAAAACTGGTAAGTCTGCT
ACCACCACCACCCCAGCTGGTGGCAATTCAACAGGCAATGGTACTACTAGTTCTTCAAATACCACCACTAATGGTGGCAATAGTGGGAGTTACAGGATTA
AGGAGATGAATGTGGGCTTCTGTTTTGCTGTGTTTGTTCTTCTTGCTAGTTTCATTGTTTTCTAG
AA sequence
>Potri.002G249200.1 pacid=42777861 polypeptide=Potri.002G249200.1.p locus=Potri.002G249200 ID=Potri.002G249200.1.v4.1 annot-version=v4.1
MASLPFSALSLFFSLCVLLVLPTHSLTCSTSQKFTNNKHYTNCTALPALKSYLHYTYNSSNSSLSVAFIASPAKPDGWTGWGINLNGTGMAGAQVILALK
SSKGAPEVKTYNIISYGDIREERLSFDVWDLSAETNATSGEFTIYASVKLPEKVESFNHIWQVGAAVNNGKPVKHEFAAENKDAKATLELTTAQKTGKSA
TTTTPAGGNSTGNGTTSSSNTTTNGGNSGSYRIKEMNVGFCFAVFVLLASFIVF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07390 AIR12 Auxin-Induced in Root cultures... Potri.002G249200 0 1 AIR12.1
AT5G24170 Got1/Sft2-like vescicle transp... Potri.015G017300 6.32 0.7664
AT1G47655 DOF Dof-type zinc finger DNA-bindi... Potri.002G129600 14.56 0.7442
AT5G53880 unknown protein Potri.001G398700 28.54 0.7238
AT5G64667 IDL2 inflorescence deficient in abs... Potri.007G110700 96.23 0.6817
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Potri.014G027100 96.48 0.6889 Pt-HSFB4.2
AT5G20590 TBL5 TRICHOME BIREFRINGENCE-LIKE 5 ... Potri.006G071500 154.72 0.6677
AT4G23720 Protein of unknown function (D... Potri.001G096000 235.64 0.6373

Potri.002G249200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.