Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB11.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05810 333 / 7e-117 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT3G07410 330 / 3e-116 AtRABA5b RAB GTPase homolog A5B (.1) AT2G31680 327 / 7e-115 AtRABA5d RAB GTPase homolog A5D (.1) AT2G43130 327 / 7e-115 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G47520 274 / 5e-94 AtRABA5a RAB GTPase homolog A5A (.1) AT3G12160 243 / 8e-82 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT5G47960 242 / 3e-81 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT1G07410 238 / 9e-80 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT4G18430 237 / 2e-79 AtRABA1e RAB GTPase homolog A1E (.1) AT1G16920 234 / 1e-78 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G231800 [exp] 336 / 1e-118 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.014G150300 [exp] 331 / 1e-116 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.006G015400 [exp] 271 / 6e-93 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.016G010300 [exp] 270 / 2e-92 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G057700 [exp] 245 / 8e-83 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.001G270100 [exp] 246 / 9e-83 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.016G050400 [exp] 242 / 2e-81 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.006G000300 [exp] 239 / 3e-80 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 236 / 3e-79 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025876 [exp] 341 / 1e-120 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10038226 [exp] 340 / 3e-120 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10026731 [exp] 337 / 6e-119 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 337 / 6e-119 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10017558 [exp] 273 / 1e-93 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 273 / 2e-93 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10038807 [exp] 272 / 5e-93 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10012032 [exp] 244 / 2e-82 AT3G12160 379 / 1e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10016284 [exp] 242 / 2e-81 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10023829 [exp] 244 / 6e-80 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.002G249500.1 pacid=42778890 polypeptide=Potri.002G249500.1.p locus=Potri.002G249500 ID=Potri.002G249500.1.v4.1 annot-version=v4.1 ATGGGTCGAGAACAAGAAGAAGGGGAAGGGGGTGAAGAGTACTTGTTCAAGATAGTGGTCATAGGAGACTCTGCTGTTGGGAAATCCAACTTGTTGTCAA GATTTGCTAGAAATGAGTTTGATAGCAATTCAAAGGCTACAATTGGGGTAGAGTTCCAGACCCAAGTGGTGGATATTGATGGCAAAGAAATCAAGGCACA GATCTGGGACACTGCTGGTCAAGAGAGGTTTAGAGCTGTCACCTCTGCTTACTATAGAGGTGCCGTTGGTGCTCTCATTGTTTATGATATCACCAGGAGG ACAAGCTTTGATAGTGTTAAGAGGTGGCTTGATGAACTTGGCACTCATTGCGACACTGCGATCGCTAGAATGCTTGTAGGGAACAAGTGTGATCTTGACA GTATCAGAGAAGTGAGTAGAGACGAGGGCAAGAGCCTTGCGGAGGAAGAAAGTCTATTCTTCATGGAGACATCTGCCCTTGATTCTACTAATGTTGAAGC TGCTTTCGAGGTTGTTATCCGTGAAATCTACAATAATATGAGCAGGAAAATCTTAAACTCTGATTCATACAAGGCTGAGCTGACAGCCAATCGAGTGAGC CTGGTGAATGGGGACACCTCGTCCAAAAAGTATGGCTTCTCTTGCTGCAATACATAG
AA sequence Show only first row Show all	>Potri.002G249500.1 pacid=42778890 polypeptide=Potri.002G249500.1.p locus=Potri.002G249500 ID=Potri.002G249500.1.v4.1 annot-version=v4.1 MGREQEEGEGGEEYLFKIVVIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEIKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDITRR TSFDSVKRWLDELGTHCDTAIARMLVGNKCDLDSIREVSRDEGKSLAEEESLFFMETSALDSTNVEAAFEVVIREIYNNMSRKILNSDSYKAELTANRVS LVNGDTSSKKYGFSCCNT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.002G249500 [exp]	0	1	RAB11.3
AT2G14880			SWIB/MDM2 domain superfamily p...		Potri.009G092200 [exp]	3.16	0.8063
AT2G33255			Haloacid dehalogenase-like hyd...		Potri.010G063700 [exp]	3.87	0.7686
AT3G10940		LSF2	LIKE SEX4 2, dual specificity ...		Potri.019G048600 [exp]	4.00	0.7705
					Potri.001G340100 [exp]	8.66	0.7749
AT1G29150		RPN6, ATS9	REGULATORY PARTICLE NON-ATPASE...		Potri.013G020300 [exp]	10.00	0.7332	ATS9.2
AT2G43710		FAB2, SSI2	suppressor of SA insensitive 2...		Potri.013G127300 [exp]	10.00	0.7105
AT4G01310			Ribosomal L5P family protein (...		Potri.014G089100 [exp]	11.66	0.7535	RPL5.2
AT5G50090			unknown protein		Potri.015G072501 [exp]	14.56	0.6817
AT1G14720		ATXTH28, EXGT-A...	xyloglucan endotransglycosylas...		Potri.008G138400 [exp]	15.16	0.7088	EXGT.4
AT5G53280		PDV1	plastid division1 (.1)		Potri.012G032200 [exp]	17.97	0.7121

Compare expression of checked genes

Potri.002G249500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.