Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48540 255 / 9e-86 receptor-like protein kinase-related family protein (.1) AT3G22060 141 / 4e-41 Receptor-like protein kinase-related family protein (.1) AT4G23180 113 / 1e-28 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G38830 110 / 1e-27 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) AT3G58310 104 / 7e-27 Domain of unknown function (DUF26) (.1) AT4G21230 101 / 2e-24 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1) AT4G23160 100 / 4e-24 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23170 97 / 5e-24 CRK9, EP1 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 9, receptor-like protein kinase-related family protein (.1) AT4G05200 100 / 7e-24 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G23140 100 / 8e-24 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120500 [exp] 142 / 1e-41 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1) Potri.007G120700 [exp] 138 / 5e-40 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120400 [exp] 137 / 7e-40 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120401 [exp] 137 / 7e-40 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1) Potri.017G039966 [exp] 137 / 1e-39 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1) Potri.017G040450 [exp] 134 / 2e-38 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120501 [exp] 130 / 5e-37 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1) Potri.017G040049 [exp] 125 / 5e-35 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1) Potri.017G040300 [exp] 124 / 2e-34 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038227 [exp] 249 / 3e-83 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1) Lus10025875 [exp] 230 / 9e-76 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1) Lus10027145 [exp] 128 / 4e-36 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1) Lus10018380 [exp] 109 / 1e-27 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007632 [exp] 106 / 4e-26 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10026629 [exp] 106 / 4e-26 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10031581 [exp] 105 / 1e-25 AT4G23310 213 / 2e-60 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015095 [exp] 103 / 4e-25 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015091 [exp] 103 / 6e-25 AT5G54650 556 / 1e-178 FORMIN HOMOLOGY 5, formin homology5 (.1.2) Lus10018379 [exp] 102 / 2e-24 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.002G249600.1 pacid=42777945 polypeptide=Potri.002G249600.1.p locus=Potri.002G249600 ID=Potri.002G249600.1.v4.1 annot-version=v4.1 ATGAATTTATTATCCATCCTTCTCCTCCTATTATTGCTATGCACTTGCAGTGCAGATCGTGCGGGAGAGTTCTGCAATGCAGACAGCGAAATAAGTGGCA ACAGCCAGATATTTGCAAATATTGACAGGTTATTGCCTGTGTTGGTTTTCAGGACTGCCTTGACTGGTTTTGCTACTGTCACATATGGCAAAGGACAAGA CAAAGTCCATGGTCTAGCACAATGCAGAGGAGATGTGAGCAGCAAAGACTGCTTCAGTTGTATCCAAGATGCAGCAAAGCAAATCCGTGAAGTTTGTCCA GACCAGGCCGATGCCAGGATTTGGTTCGAATACTGCTTTTTACGGTATGACAACATAAATTTCATTGGAAAAGTTGATACAGATTTTAGCACAGTCTACT TTAATCTAGCAGCTCTGACGGATCAGATAAGAGCTGAAGCTGTTTTTCCTGGGAATAGAGGGCTGGGAAAGGGTGAAAAGAAACTATCTAGATTTGTGAA ACTTTATGCTCTGGTTCAGTGCATTAGGGACCTATCTCGGATAGACTGTGCACAGTGTCTGGCTATTGCTATTGGAAGTTTCCCTGACTTTTGTGATGAC AGAAAGGGATGTCGAATTTTCTATAGCATCTGTTACGTTCGATATGAGCTCTATCCATTTTTCTTCCCCATTGATTCCAGAAATTCCCTGGTTAATACTT CAATGGTTGTAGCTAATCCCTAG
AA sequence Show only first row Show all	>Potri.002G249600.1 pacid=42777945 polypeptide=Potri.002G249600.1.p locus=Potri.002G249600 ID=Potri.002G249600.1.v4.1 annot-version=v4.1 MNLLSILLLLLLLCTCSADRAGEFCNADSEISGNSQIFANIDRLLPVLVFRTALTGFATVTYGKGQDKVHGLAQCRGDVSSKDCFSCIQDAAKQIREVCP DQADARIWFEYCFLRYDNINFIGKVDTDFSTVYFNLAALTDQIRAEAVFPGNRGLGKGEKKLSRFVKLYALVQCIRDLSRIDCAQCLAIAIGSFPDFCDD RKGCRIFYSICYVRYELYPFFFPIDSRNSLVNTSMVVANP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48540			receptor-like protein kinase-r...		Potri.002G249600 [exp]	0	1
AT2G44745	WRKY	WRKY12	WRKY family transcription fact...		Potri.002G138900 [exp]	1.73	0.8539
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.010G027600 [exp]	2.44	0.8464
AT1G56130			Leucine-rich repeat transmembr...		Potri.006G255100 [exp]	2.82	0.8311
AT5G64700			nodulin MtN21 /EamA-like trans...		Potri.011G148600 [exp]	3.00	0.7914
AT1G25530			Transmembrane amino acid trans...		Potri.010G128300 [exp]	3.16	0.7825
AT3G47570			Leucine-rich repeat protein ki...		Potri.008G033900 [exp]	6.00	0.7958
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.008G099000 [exp]	7.74	0.8328
AT5G15710			Galactose oxidase/kelch repeat...		Potri.004G112400 [exp]	8.66	0.6965
AT2G31800			Integrin-linked protein kinase...		Potri.017G007800 [exp]	9.89	0.7739
AT1G59740			Major facilitator superfamily ...		Potri.004G229000 [exp]	10.39	0.7672

Compare expression of checked genes

Potri.002G249600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.