Potri.002G250800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48500 100 / 1e-27 unknown protein
AT5G18310 50 / 1e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G029600 83 / 1e-20 AT5G18310 94 / 2e-24 unknown protein
Potri.013G052600 81 / 7e-20 AT5G18310 97 / 8e-26 unknown protein
Potri.015G040500 56 / 4e-11 AT5G18310 59 / 2e-12 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009584 114 / 7e-33 AT5G48500 126 / 3e-37 unknown protein
Lus10020403 112 / 4e-32 AT5G48500 127 / 7e-38 unknown protein
Lus10042520 51 / 2e-08 AT5G18310 81 / 1e-19 unknown protein
Lus10021984 51 / 3e-08 AT5G18310 76 / 2e-17 unknown protein
Lus10011841 40 / 0.0002 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10022776 40 / 0.0004 AT3G25070 155 / 4e-47 RPM1 interacting protein 4 (.1)
PFAM info
Representative CDS sequence
>Potri.002G250800.1 pacid=42776964 polypeptide=Potri.002G250800.1.p locus=Potri.002G250800 ID=Potri.002G250800.1.v4.1 annot-version=v4.1
ATGGAAGATTATTATTATTCAAGGAGCCATGTACCAGCATTTGGAAGCTGGGACTGGAACAATGATATGCCTTTCACTCAGTGCTTTGAATCAGCCAGGC
AAGCAGGTCTGCTTCGTTACAGTTACTCAGAAGATCGTGATCTCTATGTTGCTGGTGATCTCTATGAGAATGATGTTGTCACTCCTACCATGATCGTCGT
TCCTCGCCGAAGGGAAAAAATGCGTCGCCCTCGTGCCAAAGAAGAGAAAAGGGAGCAAAGTTGGGCGGTGACAAGTGATGTAAAGGAATCGCCAAGTCCT
CCTCCGATGTCGACCAGGCCAACACCTAAGCCAGTTGACGAGGACTTGTATAAAATCTCACCGGAGCTCCTTTATGCAAAAACCAAAAAGAGGGGAGGGC
TGTGCTTCTTTTCAAGCTGCTTGATGCCCGCCTGTGCTCTTTGA
AA sequence
>Potri.002G250800.1 pacid=42776964 polypeptide=Potri.002G250800.1.p locus=Potri.002G250800 ID=Potri.002G250800.1.v4.1 annot-version=v4.1
MEDYYYSRSHVPAFGSWDWNNDMPFTQCFESARQAGLLRYSYSEDRDLYVAGDLYENDVVTPTMIVVPRRREKMRRPRAKEEKREQSWAVTSDVKESPSP
PPMSTRPTPKPVDEDLYKISPELLYAKTKKRGGLCFFSSCLMPACAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G48500 unknown protein Potri.002G250800 0 1
AT5G51160 Ankyrin repeat family protein ... Potri.014G050600 2.44 0.9730
AT1G63310 unknown protein Potri.001G452900 8.48 0.9705
AT3G50160 Plant protein of unknown funct... Potri.006G042300 8.94 0.9661
AT5G41470 Nuclear transport factor 2 (NT... Potri.002G070800 9.32 0.9700
AT5G35740 Carbohydrate-binding X8 domain... Potri.006G016800 10.95 0.9690
AT1G63310 unknown protein Potri.011G149100 11.83 0.9699
AT3G15680 Ran BP2/NZF zinc finger-like s... Potri.001G172700 11.83 0.9441
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Potri.001G419200 12.96 0.9681
AT1G09812 unknown protein Potri.003G006900 13.78 0.8595
AT1G54860 Glycoprotein membrane precurso... Potri.005G034200 16.30 0.9672

Potri.002G250800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.