Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 76 / 2e-19 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 71 / 3e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55410 65 / 6e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G55460 56 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 46 / 9e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G07450 37 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149900 [exp] 86 / 5e-23 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 68 / 5e-16 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 68 / 5e-16 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G137400 [exp] 37 / 0.0003 AT5G52160 87 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038233 [exp] 102 / 2e-29 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 101 / 2e-29 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002741 [exp] 82 / 8e-22 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016323 [exp] 72 / 2e-17 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 69 / 9e-17 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 62 / 1e-13 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032575 [exp] 57 / 7e-12 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10030541 [exp] 39 / 0.0001 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10009872 [exp] 37 / 0.0005 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000397 [exp] 37 / 0.0009 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.002G251000.2 pacid=42779880 polypeptide=Potri.002G251000.2.p locus=Potri.002G251000 ID=Potri.002G251000.2.v4.1 annot-version=v4.1 ATGGAGATGGCGAAGAGGCAGCTGGTGGTGTTGCTATTGGTGGTGGTTGCTTTGTTTGAGGGCTCACGGGCAGTGAGCGTGTGTGACATTAGTGAGGATG GTCTCGCAGCCTGCAAGCCATCTGTGACCAAACCAGACCCAGTTGAGCCGCCATCAGTTGATTGTTGCAAGGCTGTTTCTGGGGCTAACTTCACATGCCT TTGCTCTTACAAGAATTCATACCTGTTGCCTTATCTCGGCATCGATCCTGATCTTGCCATGGCTTTGCCTTCCAAGTGCAACCTCAGCACTGCTGTGCCT AGCTGCTAA
AA sequence Show only first row Show all	>Potri.002G251000.2 pacid=42779880 polypeptide=Potri.002G251000.2.p locus=Potri.002G251000 ID=Potri.002G251000.2.v4.1 annot-version=v4.1 MEMAKRQLVVLLLVVVALFEGSRAVSVCDISEDGLAACKPSVTKPDPVEPPSVDCCKAVSGANFTCLCSYKNSYLLPYLGIDPDLAMALPSKCNLSTAVP SC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48485		DIR1	DEFECTIVE IN INDUCED RESISTANC...		Potri.002G251000 [exp]	0	1
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.001G309500 [exp]	4.47	0.8358	Pt-PEAC14.1,ACT1
AT5G41050			Pollen Ole e 1 allergen and ex...		Potri.001G326200 [exp]	6.92	0.8174
AT5G53880			unknown protein		Potri.001G398700 [exp]	10.77	0.8172
AT3G51080	GATA	GATA6	GATA transcription factor 6 (....		Potri.007G016600 [exp]	14.49	0.7318
AT5G07240		IQD24	IQ-domain 24 (.1)		Potri.012G139800 [exp]	15.65	0.8167
AT1G73620			Pathogenesis-related thaumatin...		Potri.012G047800 [exp]	16.30	0.8006
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.019G010400 [exp]	16.91	0.8193	PEAC14.4
AT4G15802		AtHSBP	Arabidopsis thaliana heat shoc...		Potri.010G025000 [exp]	17.14	0.7778
AT1G14890			Plant invertase/pectin methyle...		Potri.008G132600 [exp]	21.63	0.7508
AT2G17230		EXL5	EXORDIUM like 5 (.1)		Potri.004G206600 [exp]	25.49	0.7380

Compare expression of checked genes

Potri.002G251000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.