Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47070 38 / 0.0003 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G149100 [exp] 87 / 1e-21 AT5G47070 496 / 7e-176 Protein kinase superfamily protein (.1) Potri.003G085300 [exp] 81 / 3e-19 AT5G47070 472 / 6e-166 Protein kinase superfamily protein (.1) Potri.014G052700 [exp] 57 / 7e-11 AT5G47070 431 / 2e-149 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040135 [exp] 44 / 5e-06 AT5G47070 456 / 3e-160 Protein kinase superfamily protein (.1) Lus10001088 [exp] 42 / 1e-05 AT5G47070 455 / 4e-160 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G251300.1 pacid=42776723 polypeptide=Potri.002G251300.1.p locus=Potri.002G251300 ID=Potri.002G251300.1.v4.1 annot-version=v4.1 ATGAAGTGTTTCTATGTTTTCAAGGATAAATCCAGGAACCAGAAAGGGCAAGCAAATTCAGCCCCAGAATTGAGAGAACAGAGCAAATCCAATAGTTCAG CTATGAGTCGTGCAGCGAAATCCCCACCACCTCCAAGAAGCATGCCTGAATTGTACAAGGAGAAGGAGCACAATTTGCGAGTTTTCAGTTTTCAAGAGCT CAGAGAGGCAGCAAATGGTTTTTTAACAGGTTGCTTAAGATCGGAGAAGGTGGCTTTTGGAGTGTTTTCAAGGAAACAACCAGACTAG
AA sequence Show only first row Show all	>Potri.002G251300.1 pacid=42776723 polypeptide=Potri.002G251300.1.p locus=Potri.002G251300 ID=Potri.002G251300.1.v4.1 annot-version=v4.1 MKCFYVFKDKSRNQKGQANSAPELREQSKSNSSAMSRAAKSPPPPRSMPELYKEKEHNLRVFSFQELREAANGFLTGCLRSEKVAFGVFSRKQPD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G17660			Protein kinase superfamily pro...		Potri.002G251300 [exp]	0	1
AT4G03150			unknown protein		Potri.014G135400 [exp]	3.00	0.7097
AT1G36390			Co-chaperone GrpE family prote...		Potri.005G171201 [exp]	7.74	0.6467
AT1G11480			eukaryotic translation initiat...		Potri.011G031900 [exp]	9.00	0.6511
AT2G33255			Haloacid dehalogenase-like hyd...		Potri.010G063700 [exp]	11.83	0.6812
AT3G56720			unknown protein		Potri.016G036000 [exp]	13.26	0.6476
AT3G13898			unknown protein		Potri.003G042300 [exp]	16.18	0.6945
					Potri.001G456100 [exp]	16.79	0.5485
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.002G249500 [exp]	18.97	0.6762	RAB11.3
AT3G10940		LSF2	LIKE SEX4 2, dual specificity ...		Potri.019G048600 [exp]	19.26	0.6593
AT3G62810			complex 1 family protein / LVR...		Potri.014G129800 [exp]	57.31	0.6423

Compare expression of checked genes

Potri.002G251300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.