Potri.002G253701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G253701.1 pacid=42777318 polypeptide=Potri.002G253701.1.p locus=Potri.002G253701 ID=Potri.002G253701.1.v4.1 annot-version=v4.1
ATGAACATTCCTTGGACTTCACTAATTTCTTTTTATAGTTGCTTGAACTGTATGATAGATTCTTCCCCGAGGTCAATAAGAAATCATCAACGGCAAAAGC
ACATGTTAGGTAAGGAAAAAACTCGATCAAACGAGGCATCATCATCTTCTATCTCACCTTTTGTAGTGCTTGAACTGTATACATCTTTGGTCTAA
AA sequence
>Potri.002G253701.1 pacid=42777318 polypeptide=Potri.002G253701.1.p locus=Potri.002G253701 ID=Potri.002G253701.1.v4.1 annot-version=v4.1
MNIPWTSLISFYSCLNCMIDSSPRSIRNHQRQKHMLGKEKTRSNEASSSSISPFVVLELYTSLV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G253701 0 1
Potri.013G104501 36.49 0.4537
AT3G63400 Cyclophilin-like peptidyl-prol... Potri.010G080800 55.85 0.4372
AT4G16447 unknown protein Potri.011G086300 66.52 0.4031
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Potri.015G077700 70.01 0.4492
Potri.005G022200 116.68 0.3812
AT1G14200 RING/U-box superfamily protein... Potri.011G119900 147.51 0.3630
AT1G49330 hydroxyproline-rich glycoprote... Potri.004G152600 155.56 0.3653
AT1G22110 structural constituent of ribo... Potri.005G169900 189.12 0.3573
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Potri.008G049801 298.99 0.3048

Potri.002G253701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.