Plant FIBer expression Database

PSAE1.1 (Potri.002G253800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PSAE1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20260 107 / 2e-30 PSAE-2 photosystem I subunit E-2 (.1)
AT4G28750 104 / 2e-29 PSAE-1, PSAE1 PSA E1 KNOCKOUT, Photosystem I reaction centre subunit IV / PsaE protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022846
[exp]
111 / 6e-32 AT2G20260 128 / 9e-39 photosystem I subunit E-2 (.1)
Lus10011913
[exp]
110 / 1e-31 AT2G20260 126 / 5e-38 photosystem I subunit E-2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0610 ETAP PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Representative CDS sequence
>Potri.002G253800.2 pacid=42776735 polypeptide=Potri.002G253800.2.p locus=Potri.002G253800 ID=Potri.002G253800.2.v4.1 annot-version=v4.1
ATGGCTAGCTGCAACATGGCATCAGCTGCATCAGGATTTGCGTTGGCACCAACTGTTGCAACCAATACAAACTCAACTTCTAAGCCCACCATGTTGTTTT
TCTCTTCAAAGAACAACAACAAGAACTATTCGAGGCTTGTCGTAAGGTCAGCTGAAGAGGGTGCATCACCACCTGCTGCCACCACAGAACCAGCTGTAGC
TGAAGCTCCAAAACCTAAGCCACCACCTATTGGACCCAAGAGAGGAACCAAGGTGAAGATACTGAGGAAGGAATCCTACTGGTTCAATGGCGTTGGATCC
GTAGTAGCTGTTGATCAGGACCCCAGGAGCCGCTACCCGGTGGTGGTTCGATTCAACAAGGTTAATTATGCAAATGTATCTACAAACAACTACGCCTTGG
ATGAAATCGAAGAAGTAAAATGA
AA sequence
>Potri.002G253800.2 pacid=42776735 polypeptide=Potri.002G253800.2.p locus=Potri.002G253800 ID=Potri.002G253800.2.v4.1 annot-version=v4.1
MASCNMASAASGFALAPTVATNTNSTSKPTMLFFSSKNNNKNYSRLVVRSAEEGASPPAATTEPAVAEAPKPKPPPIGPKRGTKVKILRKESYWFNGVGS
VVAVDQDPRSRYPVVVRFNKVNYANVSTNNYALDEIEEVK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20260 PSAE-2 photosystem I subunit E-2 (.1) Potri.002G253800
[exp]
0 1 PSAE1.1
AT4G01150 unknown protein Potri.014G093900
[exp]
1.00 0.9913 CAM2.1
AT4G12800 PSAL photosystem I subunit l (.1) Potri.014G175600
[exp]
2.00 0.9886 PSAL.2
AT1G32470 Single hybrid motif superfamil... Potri.001G144800
[exp]
2.44 0.9822 gdcH4,GDCH.2
AT4G01150 unknown protein Potri.002G166800
[exp]
2.44 0.9863 CAM2.2
AT4G04640 ATPC1 ATPase, F1 complex, gamma subu... Potri.011G003800
[exp]
3.46 0.9853
AT1G55670 PSAG photosystem I subunit G (.1) Potri.001G471900
[exp]
4.47 0.9841 Pt-PSAG.1
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Potri.019G087300
[exp]
5.91 0.9815
AT2G42220 Rhodanese/Cell cycle control p... Potri.006G059200
[exp]
6.24 0.9757
AT3G55330 PPL1 PsbP-like protein 1 (.1) Potri.010G210200
[exp]
7.41 0.9796
Potri.004G068600
[exp]
7.74 0.9779

Potri.002G253800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.