Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrcGrx_S12
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28730 175 / 2e-56 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT2G20270 170 / 4e-54 Thioredoxin superfamily protein (.1.2) AT5G40370 94 / 3e-25 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT5G63030 94 / 6e-25 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G20500 94 / 1e-24 Glutaredoxin family protein (.1) AT5G18600 82 / 1e-20 Thioredoxin superfamily protein (.1) AT1G77370 79 / 5e-19 Glutaredoxin family protein (.1) AT4G15700 75 / 6e-18 Thioredoxin superfamily protein (.1) AT4G15680 74 / 2e-17 Thioredoxin superfamily protein (.1) AT4G15690 73 / 5e-17 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G133400 [exp] 95 / 3e-25 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.015G078900 [exp] 94 / 5e-25 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.001G347700 [exp] 90 / 1e-23 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.012G082800 [exp] 89 / 6e-23 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.007G017300 [exp] 77 / 3e-18 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.014G134000 [exp] 75 / 8e-18 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 74 / 1e-17 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.002G208400 [exp] 74 / 2e-17 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.014G133800 [exp] 72 / 1e-16 AT1G03020 142 / 1e-45 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022844 [exp] 182 / 9e-59 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10011915 [exp] 154 / 7e-48 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10022253 [exp] 102 / 2e-28 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 102 / 2e-28 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10021590 [exp] 98 / 2e-26 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10001237 [exp] 97 / 2e-26 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10042104 [exp] 96 / 2e-25 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10017148 [exp] 96 / 2e-25 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10028355 [exp] 87 / 4e-22 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1) Lus10033965 [exp] 73 / 4e-17 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.002G254100.1 pacid=42778842 polypeptide=Potri.002G254100.1.p locus=Potri.002G254100 ID=Potri.002G254100.1.v4.1 annot-version=v4.1 ATGGCAGACACACTCACAAATCTCACACCTCCTCTTCCTCTCAAATCTTCTCGCACTCTCTCTTCCCTTCGTGGCCTCCCCATTTGCTCAACCCCATTAA GCAACAATAGCAGCAGCAGCCTTAAGACAACTAGTACCTGCAGCAGGATCCTTAGCATCAATGGGCCAAAAAGATACAGACCCATGTCGGCTCGAGCTAC GGACTCCTCCTCACCTTCTTCTTCCTTTGGGTCCAGGCTCGAAGACGCCGTCAAGAAGACTGTAGCTGAGAACCCAGTTGTAGTTTACTCCAAAACTTGG TGTTCGTATTCTTTTGAGGTGAAGTCTTTGTTCAAGAGGCTAAATGTGGATCCATTAGTCGTTGAATTGGACGAATTAGGCGCTCAAGGACCCCAGATAC AGAAAGTATTAGAGAGGCTCACAGGCCAACACACTGTTCCAAATGTGTTTATTGGGGGCAAACATATCGGTGGCTGCACAGATACTGTGAAACTATACCG TAAAGGTGAACTTGAACCGCTGTTGTCAGAAGCTAATGCTAAAAAGTCACAGGGCTAG
AA sequence Show only first row Show all	>Potri.002G254100.1 pacid=42778842 polypeptide=Potri.002G254100.1.p locus=Potri.002G254100 ID=Potri.002G254100.1.v4.1 annot-version=v4.1 MADTLTNLTPPLPLKSSRTLSSLRGLPICSTPLSNNSSSSLKTTSTCSRILSINGPKRYRPMSARATDSSSPSSSFGSRLEDAVKKTVAENPVVVYSKTW CSYSFEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKKSQG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28730		GrxC5	glutaredoxin C5, Glutaredoxin ...		Potri.002G254100 [exp]	0	1	PtrcGrx_S12
AT4G13220			unknown protein		Potri.002G251800 [exp]	7.54	0.9632
AT1G09795		HISN1B, ATATP-P...	ATP phosphoribosyl transferase...		Potri.019G057200 [exp]	10.24	0.9352
AT3G52150			RNA-binding (RRM/RBD/RNP motif...		Potri.009G065900 [exp]	15.74	0.9535
AT4G34880			Amidase family protein (.1)		Potri.004G169300 [exp]	16.52	0.9241
AT3G27830		RPL12-A	ribosomal protein L12-A (.1)		Potri.001G346100 [exp]	19.67	0.9503	Pt-RPL12.6
AT5G28750			Bacterial sec-independent tran...		Potri.005G053400 [exp]	19.67	0.9182
AT2G43090			Aconitase/3-isopropylmalate de...		Potri.003G107800 [exp]	22.51	0.9129
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Potri.012G098300 [exp]	22.62	0.9354
AT2G43030			Ribosomal protein L3 family pr...		Potri.013G070100 [exp]	24.79	0.9491
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Potri.004G140500 [exp]	24.81	0.9494

Compare expression of checked genes

Potri.002G254100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.