Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1) AT4G28703 133 / 8e-42 RmlC-like cupins superfamily protein (.1) AT4G10300 125 / 2e-38 RmlC-like cupins superfamily protein (.1) AT4G10280 65 / 1e-14 RmlC-like cupins superfamily protein (.1) AT2G32650 50 / 6e-09 RmlC-like cupins superfamily protein (.1.2) AT2G32180 50 / 7e-09 PTAC18 plastid transcriptionally active 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G089600 [exp] 117 / 6e-35 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1) Potri.014G156900 [exp] 49 / 3e-08 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025947 [exp] 157 / 4e-51 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1) Lus10014252 [exp] 155 / 2e-50 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1) Lus10035659 [exp] 119 / 2e-35 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1) Lus10037245 [exp] 101 / 2e-28 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1) Lus10035660 [exp] 100 / 6e-28 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1) Lus10030017 [exp] 47 / 2e-07 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1) Lus10035307 [exp] 45 / 7e-07 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF05899 [poplar] [flax] Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence Show only first row Show all	>Potri.002G254800.1 pacid=42776795 polypeptide=Potri.002G254800.1.p locus=Potri.002G254800 ID=Potri.002G254800.1.v4.1 annot-version=v4.1 ATGGCTGAAAACCTAAGAATCATCGTTGAGACGAACCCCTCACAGTCACGACTCAGTGAACTTAACTTCAAGTGCTGGCCCAAATGGGGTTGCTCTCCAG GGAGGTATCAGCTAAAGTTTGATGCAGAGGAGACGTGCTATTTGGTGAAAGGGAAGGTGAAAGTGTACCCAAAAGGGTCGTTGGAGTTTGTGGAGTTTGG TGCGGGGGATCTTGTGACCATACCCAGAGGACTCAGTTGCACCTGGGATGTGTCTGTTGCTGTTGATAAATACTATAAATTCGAGTCATCTTCATCCCCG CCACCTTCTTCTTCATCGCAGTCAAGCTAG
AA sequence Show only first row Show all	>Potri.002G254800.1 pacid=42776795 polypeptide=Potri.002G254800.1.p locus=Potri.002G254800 ID=Potri.002G254800.1.v4.1 annot-version=v4.1 MAENLRIIVETNPSQSRLSELNFKCWPKWGCSPGRYQLKFDAEETCYLVKGKVKVYPKGSLEFVEFGAGDLVTIPRGLSCTWDVSVAVDKYYKFESSSSP PPSSSSQSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04300			RmlC-like cupins superfamily p...		Potri.002G254800 [exp]	0	1
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.014G141400 [exp]	2.64	0.8815
AT2G23460		ATXLG1, XLG1	extra-large G-protein 1 (.1)		Potri.009G109400 [exp]	7.48	0.8804
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Potri.018G019800 [exp]	8.48	0.8731
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.017G009500 [exp]	12.24	0.8589
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.019G123500 [exp]	12.48	0.8743
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Potri.012G048700 [exp]	15.58	0.8485	Pt-GT4.1
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Potri.003G005200 [exp]	16.24	0.8311
AT3G47780		ABCA7, ATATH6	A. THALIANA ABC2 HOMOLOG 6, AT...		Potri.012G069700 [exp]	17.74	0.8616	PtrAOH3,ATH2.3
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.004G017666 [exp]	19.77	0.8302
AT2G23150		ATNRAMP3, NRAMP...	natural resistance-associated ...		Potri.007G050600 [exp]	20.19	0.7899	Pt-NRAMP3.1

Compare expression of checked genes

Potri.002G254800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.