Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	TOM22.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43970 98 / 5e-28 ATTOM22-V, TOM22-V, TOM9-2 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1) AT1G04070 98 / 6e-28 ATTOM22-I, TOM22-I translocase of outer membrane 22-I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G192601 [exp] 148 / 6e-48 AT5G43970 98 / 4e-28 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024950 [exp] 117 / 3e-35 AT5G43970 116 / 4e-35 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1) Lus10022876 [exp] 112 / 2e-33 AT5G43970 113 / 5e-34 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04281 [poplar] [flax] Tom22 Mitochondrial import receptor subunit Tom22
Representative CDS sequence Show only first row Show all	>Potri.002G257200.1 pacid=42777614 polypeptide=Potri.002G257200.1.p locus=Potri.002G257200 ID=Potri.002G257200.1.v4.1 annot-version=v4.1 ATGGCTTCGCAGTCACGAAGAGGCGGAATCTCACTCCCCGAGAGGCGAGGACGAGGCTCGTCAAAGCAGGAACCAAACATCCTCGCTAAAATCAACAACT CTCAAATCGTATCTAAAGGAAAGGAAGCAGCATGCGACGCCGTTTTCGTCGCCAAAAAGCTCCTTAAAAGCACAGGCAAGGCCGCCTGGATTGCTGGCAC CACTTTCTTAATCCTCGCTGTTCCTTTGATTATCGAGATGGACCGTGAGCAGCAGCTCAACGAACTCGAGCTCCAGCAGCAAAGCCTTCTCGGAGCCCCG CCCGTCGGCCCTCCTCTACCCAAGTAG
AA sequence Show only first row Show all	>Potri.002G257200.1 pacid=42777614 polypeptide=Potri.002G257200.1.p locus=Potri.002G257200 ID=Potri.002G257200.1.v4.1 annot-version=v4.1 MASQSRRGGISLPERRGRGSSKQEPNILAKINNSQIVSKGKEAACDAVFVAKKLLKSTGKAAWIAGTTFLILAVPLIIEMDREQQLNELELQQQSLLGAP PVGPPLPK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Potri.002G257200 [exp]	0	1	TOM22.1
AT1G22450		ATCOX6B2, COX6B	CYTOCHROME C OXIDASE 6B2, cyto...		Potri.005G162100 [exp]	2.82	0.9507	COX6.2
AT3G04840			Ribosomal protein S3Ae (.1)		Potri.008G156300 [exp]	5.00	0.9620	RS3.2
AT2G39390			Ribosomal L29 family protein ...		Potri.006G214200 [exp]	6.32	0.9574
AT3G10950			Zinc-binding ribosomal protein...		Potri.001G149300 [exp]	7.14	0.9419	Pt-RPL37.1
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	8.83	0.9588	RPL15.3
AT4G26210			Mitochondrial ATP synthase sub...		Potri.018G055700 [exp]	8.94	0.9270
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.007G086800 [exp]	9.94	0.9490
AT5G28060			Ribosomal protein S24e family ...		Potri.008G152500 [exp]	10.09	0.9565
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.005G080700 [exp]	12.12	0.9533
AT5G15610			Proteasome component (PCI) dom...		Potri.004G116700 [exp]	13.96	0.9436

Compare expression of checked genes

Potri.002G257200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.