Potri.002G257500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04400 278 / 2e-98 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
AT2G33370 278 / 2e-98 Ribosomal protein L14p/L23e family protein (.1)
AT1G04480 278 / 2e-98 Ribosomal protein L14p/L23e family protein (.1)
ATCG00780 67 / 4e-15 ATCG00780.1, RPL14 ribosomal protein L14 (.1)
AT1G17560 42 / 2e-05 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G171200 282 / 1e-99 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G066400 282 / 1e-99 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.011G127250 190 / 1e-63 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G167700 162 / 8e-53 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.003G136400 159 / 2e-51 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.004G166200 157 / 5e-51 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G022800 44 / 8e-06 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023730 282 / 1e-99 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1)
Lus10042695 276 / 5e-97 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1)
Lus10022881 274 / 5e-96 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10011773 274 / 7e-96 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10024943 273 / 9e-96 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10020499 253 / 2e-88 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1)
Lus10012464 253 / 2e-88 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10024942 216 / 4e-74 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1)
Lus10022882 216 / 4e-74 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10008065 92 / 2e-25 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence
>Potri.002G257500.1 pacid=42779889 polypeptide=Potri.002G257500.1.p locus=Potri.002G257500 ID=Potri.002G257500.1.v4.1 annot-version=v4.1
ATGTCGAAGCGAGGAAGGGGAGGATCGGCCGGAAACAAGTTCCGCATGTCGCTGGGTCTTCCGGTGGCGGCGACGGTGAACTGCGCTGACAACACTGGAG
CGAAGAATCTCTATATCATATCAGTGAAAGGAATCAAAGGTCGCCTCAACCGTTTGCCGTCGGCTTGCGTCGGAGACATGGTGATGGCTACAGTGAAGAA
AGGAAAACCTGATCTCAGGAAGAAGGTGATGCCTGCTGTCATTGTTAGGCAGAGAAAGCCTTGGCGCAGAAAGGACGGTGTTTTCATGTATTTTGAAGAT
AATGCTGGTGTTATTGTCAATCCCAAGGGAGAAATGAAAGGATCCGCCATCACTGGACCCATCGGCAAGGAATGTGCTGATTTGTGGCCAAGAATTGCCA
GTGCTGCCAATGCCATCGTCTGA
AA sequence
>Potri.002G257500.1 pacid=42779889 polypeptide=Potri.002G257500.1.p locus=Potri.002G257500 ID=Potri.002G257500.1.v4.1 annot-version=v4.1
MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFED
NAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.002G257500 0 1
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Potri.019G131200 1.00 0.9247 EIF2.2
AT5G62575 SDH7B, SDH7 succinate dehydrogenase 7B, su... Potri.012G077101 3.74 0.8595
AT3G52580 Ribosomal protein S11 family p... Potri.001G218700 4.24 0.9122
AT1G26880 Ribosomal protein L34e superfa... Potri.012G108400 4.47 0.8943 RPL34.4
AT5G61170 Ribosomal protein S19e family ... Potri.004G118800 8.00 0.9205 RPS19.1
AT1G13380 Protein of unknown function (D... Potri.010G124800 8.66 0.8469
AT2G15000 unknown protein Potri.001G298800 11.48 0.7688
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Potri.014G192601 12.12 0.8532
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 13.67 0.8708
AT5G18800 Cox19-like CHCH family protein... Potri.010G026000 13.96 0.8593

Potri.002G257500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.