Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47330 56 / 1e-10 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT5G52790 48 / 6e-08 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G33700 45 / 7e-07 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT1G03270 45 / 8e-07 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT2G14520 44 / 3e-06 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14240 44 / 3e-06 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) AT4G14230 42 / 9e-06 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G196900 [exp] 54 / 4e-10 AT1G47330 575 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G012400 [exp] 50 / 2e-08 AT2G14520 516 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.017G147900 [exp] 48 / 5e-08 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.009G082300 [exp] 47 / 9e-08 AT2G14520 593 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.001G288000 [exp] 46 / 3e-07 AT2G14520 620 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.010G030200 [exp] 45 / 5e-07 AT4G14240 611 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.008G202100 [exp] 45 / 8e-07 AT4G14240 632 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032715 [exp] 56 / 9e-11 AT1G47330 646 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10039289 [exp] 51 / 6e-09 AT5G52790 557 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027528 [exp] 50 / 1e-08 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10005259 [exp] 49 / 4e-08 AT2G14520 679 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027527 [exp] 48 / 6e-08 AT5G52790 302 / 2e-99 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10039288 [exp] 48 / 8e-08 AT5G52790 449 / 1e-154 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012476 [exp] 47 / 1e-07 AT2G14520 591 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10030665 [exp] 47 / 2e-07 AT2G14520 498 / 3e-178 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10020494 [exp] 47 / 2e-07 AT2G14520 538 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10028010 [exp] 45 / 6e-07 AT1G03270 635 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01595 [poplar] [flax] DUF21 Cyclin M transmembrane N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.002G260401.2 pacid=42777604 polypeptide=Potri.002G260401.2.p locus=Potri.002G260401 ID=Potri.002G260401.2.v4.1 annot-version=v4.1 ATGACATCCGCGCCGGTACTCTCCCTCGTATTAGTGTTTGGAGAGATATTGGCACAAGCAGTTTGTACTCGTTTTGGCTTGACTGTTGGAGCAGCAATGG CGCCTCTTGTCCGTGTTCTTCTTTTGCTGTTCTTTCCAATTTCTTATCCAGTTAGTAAGGTTGATTTGGCTCAATTTGGCATGGATTTGAGGAACCAAAT ATTGCCATTGTTGGCTGTATTCGAAGCAAGAACTTCTTCTGTCTAA
AA sequence Show only first row Show all	>Potri.002G260401.2 pacid=42777604 polypeptide=Potri.002G260401.2.p locus=Potri.002G260401 ID=Potri.002G260401.2.v4.1 annot-version=v4.1 MTSAPVLSLVLVFGEILAQAVCTRFGLTVGAAMAPLVRVLLLLFFPISYPVSKVDLAQFGMDLRNQILPLLAVFEARTSSV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47330			CBS domain-containing protein ...		Potri.002G260401 [exp]	0	1
AT2G27430			ARM repeat superfamily protein...		Potri.011G065300 [exp]	10.09	0.7875
AT4G27290			S-locus lectin protein kinase ...		Potri.010G020200 [exp]	14.42	0.7227
					Potri.006G002301 [exp]	14.49	0.7139
AT1G07900	AS2	LBD1	LOB domain-containing protein ...		Potri.014G167100 [exp]	22.89	0.7768
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.001G132300 [exp]	24.00	0.6214
AT2G18193			P-loop containing nucleoside t...		Potri.007G020500 [exp]	24.18	0.7463
AT2G32660		AtRLP22	receptor like protein 22 (.1)		Potri.001G437800 [exp]	25.41	0.7177
AT1G74190		AtRLP15	receptor like protein 15 (.1)		Potri.018G118062 [exp]	26.19	0.7534
AT4G27290			S-locus lectin protein kinase ...		Potri.010G018600 [exp]	26.98	0.6971
AT4G27290			S-locus lectin protein kinase ...		Potri.010G017800 [exp]	26.98	0.6965

Compare expression of checked genes

Potri.002G260401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.