Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75170 428 / 1e-152 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT4G36640 382 / 2e-134 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G22180 271 / 1e-90 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) AT4G08690 262 / 3e-87 Sec14p-like phosphatidylinositol transfer family protein (.1.2) AT1G01630 85 / 3e-19 Sec14p-like phosphatidylinositol transfer family protein (.1) AT5G63060 84 / 8e-19 Sec14p-like phosphatidylinositol transfer family protein (.1) AT3G22410 81 / 6e-17 Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G05370 79 / 2e-16 Sec14p-like phosphatidylinositol transfer family protein (.1) AT5G47510 74 / 9e-15 Sec14p-like phosphatidylinositol transfer family protein (.1) AT1G14820 68 / 5e-13 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G123200 [exp] 437 / 3e-156 AT1G75170 414 / 9e-147 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.007G025900 [exp] 418 / 2e-148 AT1G75170 369 / 3e-129 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.007G025800 [exp] 417 / 2e-148 AT1G75170 408 / 2e-144 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.002G093400 [exp] 272 / 7e-90 AT4G08690 375 / 5e-130 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Potri.013G068700 [exp] 265 / 2e-87 AT1G22180 351 / 6e-121 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Potri.005G168100 [exp] 99 / 1e-24 AT4G08690 134 / 4e-38 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Potri.017G063966 [exp] 97 / 2e-23 AT1G01630 340 / 2e-118 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.003G162100 [exp] 91 / 2e-21 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1) Potri.015G023000 [exp] 91 / 2e-21 AT1G14820 276 / 5e-94 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010804 [exp] 430 / 1e-153 AT1G75170 393 / 7e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10016312 [exp] 422 / 1e-150 AT1G75170 387 / 2e-136 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10026020 [exp] 399 / 5e-140 AT1G75170 397 / 4e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10014312 [exp] 395 / 3e-139 AT1G75170 397 / 4e-140 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10025128 [exp] 391 / 2e-138 AT1G75170 380 / 3e-134 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3) Lus10020911 [exp] 278 / 2e-92 AT4G08690 376 / 1e-130 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10033464 [exp] 276 / 4e-92 AT4G08690 378 / 4e-132 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10023956 [exp] 177 / 8e-55 AT4G36640 166 / 1e-50 Sec14p-like phosphatidylinositol transfer family protein (.1.2) Lus10016733 [exp] 105 / 5e-27 AT1G01630 325 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1) Lus10040252 [exp] 99 / 4e-24 AT1G01630 319 / 8e-111 Sec14p-like phosphatidylinositol transfer family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0214 [poplar] [flax] UBA PF03765 [poplar] [flax] CRAL_TRIO_N CRAL/TRIO, N-terminal domain CL0512 [poplar] [flax] CRAL_TRIO PF13716 [poplar] [flax] CRAL_TRIO_2 Divergent CRAL/TRIO domain
Representative CDS sequence Show only first row Show all	>Potri.002G261000.1 pacid=42776838 polypeptide=Potri.002G261000.1.p locus=Potri.002G261000 ID=Potri.002G261000.1.v4.1 annot-version=v4.1 ATGTTTCTCTGGCGGAATAATACCAGCCATGATCAGGAAAATGATTCACTGCAGCATGAATCTAAGATCAATGAGCTCAAGGCTACTATTGGACCGCTAT CTGGACACAGTTTACAATATTGCACTGACGCATGCTTTAGAAGATATCTGGATGCTAGGAACTGGAATGTAGACAAAGCAAAGAAAATGCTGGAACAAAC GATTAAATGGAGATCGACATATAAACCTGAAGAGATTTGCTGGCATGAAGTTGCTGTTGAAGGTGAGACTGGAAAAATATACAGAGCGAATTTTCATGAC CGACAAGGAAGGACAGTTCTTATTTTAAGGCCAGGAATGCAGAATACAAAGTCAATAGACAATCAGATGCGGCATCTGACATATCTCATAGAGAATGCTG TCCTCAACCTACCAGAGGGTCAAGAACAAATGGCGTGGTTGATAGATTTCACTGGGTTGTCCATAAACAACACTCCACCCATAAAATCAGCTCGTGATAC TGTTAATATACTGCAAAACCACTACCCTGAGAGGCTAGCCGTGGCATTTCTTTACAATCCTCCACGAATTTTTGAAGCATTCTGGAAGATTGTCAAGTAT TTCTTGGATGCCAAAACATTCCAGAAGGTAAAATTTGTGTACCCCAAGGATAATGACAGTGTCGAACTCATGAGGTCATATTTCGACGATGAAAATCTTC CAACCGAGTTTGGAGGAAGGGCCATATTGAAGTATGACCATGAAGAGTTCTCAAGATTAATGATTGAAGATGATGCGAAGGCCGCTTCATTTTGGGGATT TGACAAGAAGCTTCAACAAGCAGTAAATGGGCATCATGGAGCCGATGGGGCTCCATCACCGGTCAGCTAG
AA sequence Show only first row Show all	>Potri.002G261000.1 pacid=42776838 polypeptide=Potri.002G261000.1.p locus=Potri.002G261000 ID=Potri.002G261000.1.v4.1 annot-version=v4.1 MFLWRNNTSHDQENDSLQHESKINELKATIGPLSGHSLQYCTDACFRRYLDARNWNVDKAKKMLEQTIKWRSTYKPEEICWHEVAVEGETGKIYRANFHD RQGRTVLILRPGMQNTKSIDNQMRHLTYLIENAVLNLPEGQEQMAWLIDFTGLSINNTPPIKSARDTVNILQNHYPERLAVAFLYNPPRIFEAFWKIVKY FLDAKTFQKVKFVYPKDNDSVELMRSYFDDENLPTEFGGRAILKYDHEEFSRLMIEDDAKAASFWGFDKKLQQAVNGHHGADGAPSPVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75170			Sec14p-like phosphatidylinosit...		Potri.002G261000 [exp]	0	1
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.018G011800 [exp]	2.00	0.9255
AT2G29990		NDA2	alternative NAD(P)H dehydrogen...		Potri.009G047100 [exp]	2.44	0.9214
AT1G79710			Major facilitator superfamily ...		Potri.001G041600 [exp]	4.24	0.8667
AT5G01450			RING/U-box superfamily protein...		Potri.014G020900 [exp]	6.24	0.8918
AT1G77590		LACS9	long chain acyl-CoA synthetase...		Potri.002G084100 [exp]	6.92	0.8326	Pt-LACS9.3
AT5G15070			Phosphoglycerate mutase-like f...		Potri.017G076400 [exp]	7.74	0.8779
AT4G26850		VTC2	mannose-1-phosphate guanylyltr...		Potri.011G087200 [exp]	10.58	0.8869	Pt-VTC2.1
					Potri.012G082300 [exp]	10.95	0.8663
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G014350 [exp]	12.48	0.8625
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Potri.019G054300 [exp]	15.19	0.8758

Compare expression of checked genes

Potri.002G261000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.