Potri.002G261500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G261500.1 pacid=42778659 polypeptide=Potri.002G261500.1.p locus=Potri.002G261500 ID=Potri.002G261500.1.v4.1 annot-version=v4.1
ATGGCACGGGATTATTTATTTATTTATTTTGCCCGGCTCTCCCCCTTCTGTGTTGGACAGGCTCCCTGTTTCCCTATCTTTCTTCCCACTTTCTTGTTTC
TGCTGGACGGATACCAAAAACATAGCACATCGTACACGGAAACCAATGTACCAGCAGGAATCAGCACTAACAACATCAATTCATCACTCAAAGGTATATT
CTGCTATCGACAAGTTAATTTCCTAATATATTATTATTCACTGTCTGCATTAAGTTATCTCCCAGCTTTTGTGGAACAGTTAACTATTTCATACATAATA
TCATAA
AA sequence
>Potri.002G261500.1 pacid=42778659 polypeptide=Potri.002G261500.1.p locus=Potri.002G261500 ID=Potri.002G261500.1.v4.1 annot-version=v4.1
MARDYLFIYFARLSPFCVGQAPCFPIFLPTFLFLLDGYQKHSTSYTETNVPAGISTNNINSSLKGIFCYRQVNFLIYYYSLSALSYLPAFVEQLTISYII
S

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G261500 0 1
Potri.001G076050 7.34 0.8917
AT2G25760 Protein kinase family protein ... Potri.018G046400 9.21 0.8543
AT3G44880 PAO, LLS1, ACD1 LETHAL LEAF-SPOT 1 HOMOLOG, AC... Potri.009G004100 11.31 0.8188
AT4G30100 P-loop containing nucleoside t... Potri.002G093500 13.96 0.8319
AT4G20090 EMB1025 embryo defective 1025, Pentatr... Potri.001G075900 14.49 0.8428
AT4G38200 SEC7-like guanine nucleotide e... Potri.009G169800 15.87 0.8057
AT3G45890 RUS1 ROOT UVB SENSITIVE 1, Protein ... Potri.003G033450 20.59 0.7690
AT4G07990 Chaperone DnaJ-domain superfam... Potri.005G146600 26.75 0.7184
AT3G16785 PLDZ1, PLDZETA1... PHOSPHOLIPASE D ZETA1, PHOSPHO... Potri.010G006300 30.39 0.7515
AT3G22470 Pentatricopeptide repeat (PPR)... Potri.019G062332 34.00 0.7843

Potri.002G261500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.