Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30942 97 / 6e-29 Protein of unknown function (DUF3317) (.1) AT1G06515 92 / 7e-27 Protein of unknown function (DUF3317) (.1), Protein of unknown function (DUF3317) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G000400 [exp] 113 / 2e-35 AT2G30942 98 / 2e-29 Protein of unknown function (DUF3317) (.1) Potri.002G263100 [exp] 108 / 2e-33 AT2G30942 100 / 5e-30 Protein of unknown function (DUF3317) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007167 [exp] 97 / 4e-29 AT2G30942 96 / 2e-28 Protein of unknown function (DUF3317) (.1) Lus10010818 [exp] 59 / 4e-13 AT1G15510 65 / 2e-15 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11779 [poplar] [flax] SPT_ssu-like Small subunit of serine palmitoyltransferase-like
Representative CDS sequence Show only first row Show all	>Potri.002G263300.3 pacid=42778831 polypeptide=Potri.002G263300.3.p locus=Potri.002G263300 ID=Potri.002G263300.3.v4.1 annot-version=v4.1 ATGAACTGGGTTCAACGTAAGATCTACCTCTATAATGTCACTTTTGGTCTTTTCATGTTGGATTGGTGGGAGCGTTGCCTTTTCAATATTCTGGTGATCG TGTTGATGTGGTTCATCTTCTACAATGGATCGCGATATGTCACTGACTTTTGCAAGAGGCATCTGTGGTGA
AA sequence Show only first row Show all	>Potri.002G263300.3 pacid=42778831 polypeptide=Potri.002G263300.3.p locus=Potri.002G263300 ID=Potri.002G263300.3.v4.1 annot-version=v4.1 MNWVQRKIYLYNVTFGLFMLDWWERCLFNILVIVLMWFIFYNGSRYVTDFCKRHLW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30942			Protein of unknown function (D...		Potri.002G263300 [exp]	0	1
AT4G15800		RALFL33	ralf-like 33 (.1)		Potri.005G025800 [exp]	9.38	0.7444	RALFL23.2
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Potri.008G080700 [exp]	10.24	0.7809
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.003G086700 [exp]	15.84	0.8153
AT4G19450			Major facilitator superfamily ...		Potri.001G128200 [exp]	17.08	0.7332
AT1G52730			Transducin/WD40 repeat-like su...		Potri.003G059500 [exp]	17.32	0.7730
AT5G42090			Lung seven transmembrane recep...		Potri.001G083100 [exp]	22.91	0.7507
AT4G29720		ATPAO5	polyamine oxidase 5 (.1)		Potri.006G151300 [exp]	23.19	0.6916
AT2G23940			Protein of unknown function (D...		Potri.018G101100 [exp]	23.68	0.8104
AT3G61610			Galactose mutarotase-like supe...		Potri.002G167200 [exp]	32.92	0.6913
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Potri.003G053400 [exp]	33.49	0.7512

Compare expression of checked genes

Potri.002G263300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.