Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71210 147 / 5e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 60 / 5e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G74580 58 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62910 58 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 57 / 2e-09 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G19890 57 / 4e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G65560 55 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G31850 54 / 4e-08 PGR3 proton gradient regulation 3 (.1) AT1G64100 54 / 5e-08 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) AT1G09900 51 / 2e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G229100 [exp] 294 / 8e-94 AT1G71210 618 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G117600 [exp] 61 / 1e-10 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 57 / 2e-09 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 56 / 9e-09 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 56 / 1e-08 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046000 [exp] 54 / 3e-08 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G066400 [exp] 54 / 5e-08 AT1G18900 1107 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3) Potri.004G013300 [exp] 54 / 6e-08 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050180 [exp] 53 / 7e-08 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009626 [exp] 200 / 1e-58 AT1G71210 649 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008998 [exp] 196 / 3e-57 AT1G71210 645 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000428 [exp] 61 / 8e-11 AT4G19890 407 / 1e-138 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10015110 [exp] 56 / 9e-09 AT1G09900 347 / 1e-112 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10031566 [exp] 53 / 9e-08 AT1G09900 349 / 3e-113 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10006083 [exp] 53 / 9e-08 AT4G19890 844 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10013841 [exp] 52 / 2e-07 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039056 [exp] 52 / 2e-07 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026558 [exp] 52 / 2e-07 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038974 [exp] 51 / 4e-07 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.003G000601.1 pacid=42787100 polypeptide=Potri.003G000601.1.p locus=Potri.003G000601 ID=Potri.003G000601.1.v4.1 annot-version=v4.1 ATGAATACGATTCTTGATCTCTTAGAGGCTTATAAATGGACGAGAGATCTTAATGTTCATCGTAATGTTACATTTCGTACTTTTATGGTAATAGGTTATG CTGTTGCTGGCAAACCAGATGTTGCACTCCAACTGCTTGCTAGAACGTGCTTCCAAGGTCATGATGCGGATGCTTTCTCTTATCATGTGCTTCTCAATTC TTTGATTGAACACAGTTTTCTTGAGGCTTTTGAGGTTGTCTATAAGCTGATCTCGTCGAGGGGTTTTGGGAATGCTGTTACCCGGTTTTTGAAGGTTAAG TATTTATGTAAAGAGAAATTGTTGGATGAGGGTAAGGGTAACTACTGTAGAAGCGGTGATAGGTTTGGATATGCACAGGCTTTGAGTTTTCTAGTTGATG GGTTTTGTCAAAATGTTTCACTTGTTAAAGCGGGCAAGTTGATTGAGGAAATTAGCGAGTTGGGGGTGGTGCCAATGGAGCCTGGTTGTGGAATTTGGTT AACGAATCTTGTTCAAGCTAGAGATATTGATGCGGCTTTCCCAGTTCCGGAAGAGCAAGGGTCCTTAGAAGGGTGCGTTCCAGATGTTTATCAGTGTAAT TTCTTGCTTTTCAGGCTACTCAAGGATAACCGTCTTGAGGATGTTTATGATTTGCTGATTGAGATGAAGGAGAATCAGCTTTCTACTAACACTTTTCTCC ATGAATGCTGCATTTTGCTTCTTTTGCAAAGCTGGAATGGTAGATGTTGCACATGA
AA sequence Show only first row Show all	>Potri.003G000601.1 pacid=42787100 polypeptide=Potri.003G000601.1.p locus=Potri.003G000601 ID=Potri.003G000601.1.v4.1 annot-version=v4.1 MNTILDLLEAYKWTRDLNVHRNVTFRTFMVIGYAVAGKPDVALQLLARTCFQGHDADAFSYHVLLNSLIEHSFLEAFEVVYKLISSRGFGNAVTRFLKVK YLCKEKLLDEGKGNYCRSGDRFGYAQALSFLVDGFCQNVSLVKAGKLIEEISELGVVPMEPGCGIWLTNLVQARDIDAAFPVPEEQGSLEGCVPDVYQCN FLLFRLLKDNRLEDVYDLLIEMKENQLSTNTFLHECCILLLLQSWNGRCCT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G71210			Pentatricopeptide repeat (PPR)...		Potri.003G000601 [exp]	0	1
AT5G08305			Pentatricopeptide repeat (PPR)...		Potri.007G073100 [exp]	7.54	0.8669
AT1G02370			Tetratricopeptide repeat (TPR)...		Potri.014G119000 [exp]	10.90	0.8374
AT5G08310			Tetratricopeptide repeat (TPR)...		Potri.005G090600 [exp]	12.64	0.8507
AT5G52850			Pentatricopeptide repeat (PPR)...		Potri.004G071800 [exp]	15.00	0.8504
AT2G29950		ELF4-L1	ELF4-like 1 (.1)		Potri.009G046400 [exp]	15.42	0.7899
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Potri.016G015550 [exp]	16.73	0.7853
AT1G69350			Tetratricopeptide repeat (TPR)...		Potri.008G093000 [exp]	19.07	0.8470
					Potri.001G042800 [exp]	20.12	0.7838
AT4G02750			Tetratricopeptide repeat (TPR)...		Potri.016G019900 [exp]	26.73	0.8444
AT5G04780			Pentatricopeptide repeat (PPR)...		Potri.010G241100 [exp]	27.74	0.8224

Compare expression of checked genes

Potri.003G000601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.