Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71210 135 / 2e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G06920 65 / 6e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G31840 64 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G46100 63 / 3e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G41170 60 / 2e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G12620 60 / 4e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22470 59 / 6e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 58 / 1e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G61990 58 / 1e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63070 55 / 2e-09 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G229100 [exp] 219 / 2e-67 AT1G71210 618 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G130600 [exp] 70 / 9e-15 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 63 / 3e-12 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.010G014100 [exp] 62 / 5e-12 AT3G06920 1404 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050240 [exp] 62 / 6e-12 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046000 [exp] 60 / 3e-11 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G046100 [exp] 60 / 3e-11 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 60 / 3e-11 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.007G123600 [exp] 60 / 4e-11 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009626 [exp] 152 / 2e-43 AT1G71210 649 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008998 [exp] 148 / 3e-42 AT1G71210 645 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026747 [exp] 64 / 1e-12 AT1G06710 1190 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025533 [exp] 64 / 2e-12 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000564 [exp] 59 / 9e-11 AT5G61370 566 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036865 [exp] 57 / 5e-10 AT1G12700 273 / 1e-83 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10019764 [exp] 56 / 9e-10 AT4G20740 590 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10032789 [exp] 56 / 1e-09 AT1G09820 250 / 4e-78 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10039071 [exp] 55 / 2e-09 AT4G16390 808 / 0.0 suppressor of variegation 7, pentatricopeptide (PPR) repeat-containing protein (.1) Lus10041927 [exp] 55 / 2e-09 AT5G18475 341 / 3e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.003G000701.1 pacid=42786785 polypeptide=Potri.003G000701.1.p locus=Potri.003G000701 ID=Potri.003G000701.1.v4.1 annot-version=v4.1 ATGCAGGATAAGGGTCACGAGCCAACTCGGAATTTATTCAGAGCTGTTATTTGCTGTCTATGTGATATGGAAAATCCAGAAATACATTTCTTCAAATTGC TGGAGATGCAACTGCCCCGTCATGAAACCAACTCTATGGTTTACAACTCCTTCATTGATGGAGATGGGCATGGCAAGAAACCTGAACTAGCCAGAGAAGT ATTTGAGATGATGCAGAGAAATGGAATCAAACCCAATGTTTGCTCTCACGCTCTTACGTTGAAGGCTTATCTGAGGAACGAAAGAATTTCTGATGCTCTA AATTTCTTTAAAGCAATGCATGATAGCAAGATGGATGTAAAGCTGTACAATTCCATGGTTGTTGGGCTCTGCGGCGTCAAAAGAACCGATCTTGCATTGA ATTTTTTTTCTGAAGGGAATGCAGAGTAA
AA sequence Show only first row Show all	>Potri.003G000701.1 pacid=42786785 polypeptide=Potri.003G000701.1.p locus=Potri.003G000701 ID=Potri.003G000701.1.v4.1 annot-version=v4.1 MQDKGHEPTRNLFRAVICCLCDMENPEIHFFKLLEMQLPRHETNSMVYNSFIDGDGHGKKPELAREVFEMMQRNGIKPNVCSHALTLKAYLRNERISDAL NFFKAMHDSKMDVKLYNSMVVGLCGVKRTDLALNFFSEGNAE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G71210			Pentatricopeptide repeat (PPR)...		Potri.003G000701 [exp]	0	1
AT3G58180			ARM repeat superfamily protein...		Potri.005G221700 [exp]	11.04	0.6510
AT2G14285			Small nuclear ribonucleoprotei...		Potri.006G167000 [exp]	18.02	0.6199
AT1G48170			unknown protein		Potri.008G099700 [exp]	38.47	0.6007
AT4G22350			Ubiquitin C-terminal hydrolase...		Potri.016G014000 [exp]	42.84	0.5905
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Potri.009G106900 [exp]	44.44	0.5932	OST1.1
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Potri.016G015550 [exp]	44.59	0.6295
					Potri.005G241602 [exp]	57.06	0.6242
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Potri.007G131500 [exp]	66.55	0.5781
AT4G33100			unknown protein		Potri.006G224400 [exp]	66.62	0.5984
AT3G15130			Tetratricopeptide repeat (TPR)...		Potri.006G244500 [exp]	79.80	0.5859

Compare expression of checked genes

Potri.003G000701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.