Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09630 381 / 2e-136 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G07410 333 / 2e-117 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 321 / 8e-113 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 318 / 2e-111 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT5G60860 303 / 9e-106 AtRABA1f RAB GTPase homolog A1F (.1) AT4G18430 299 / 6e-104 AtRABA1e RAB GTPase homolog A1E (.1) AT5G45750 295 / 1e-102 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 295 / 2e-102 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT3G15060 294 / 4e-102 AtRABA1g RAB GTPase homolog A1G (.1) AT1G16920 293 / 7e-102 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G226400 [exp] 337 / 6e-119 AT1G09630 331 / 7e-117 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.006G000300 [exp] 333 / 2e-117 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 333 / 2e-117 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 330 / 2e-116 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 322 / 6e-113 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.011G070300 [exp] 303 / 2e-105 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.019G092500 [exp] 300 / 3e-104 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.004G061000 [exp] 299 / 6e-104 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.013G123600 [exp] 296 / 5e-103 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041116 [exp] 366 / 2e-130 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10036441 [exp] 345 / 6e-122 AT1G09630 387 / 2e-138 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10001026 [exp] 329 / 6e-116 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 322 / 3e-113 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 322 / 3e-113 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10016486 [exp] 322 / 7e-113 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 321 / 1e-112 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10015297 [exp] 307 / 4e-107 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 304 / 5e-106 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 301 / 5e-105 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.003G004100.1 pacid=42785631 polypeptide=Potri.003G004100.1.p locus=Potri.003G004100 ID=Potri.003G004100.1.v4.1 annot-version=v4.1 ATGGCGAGGAGACCCGACGAGGAGTACGATTACCTGTTCAAGGTAGTGTTAATCGGCGATTCCGGTGTCGGAAAATCGAACATCCTCTCCCGATTTACTC GCAACGAGTTTTGTTTGGAGTCCAAGTCCACCATCGGCGTCGAATTCGCCACTCGCACTCTTCAAGTTGAAGGAAGGACAGTGAAGGCGCAGATATGGGA CACGGCAGGGCAAGAGCGATACAGAGCGATCACGAGTGCCTACTATAGGGGCGCGCTTGGAGCTCTTCTGGTGTATGATGTAACAAAGCCAACGACTTTT GAAAACGTGAGTCGGTGGTTGAAGGAGCTGAGGGATCATGCAGATTCCAATATTGTGATCATGTTAATTGGGAACAAGACTGATCTTAAACATCTTAGAG CAGTAGCTACTGAGGATGCTCAAAGTTATGCTGAGAAAGAAGGGCTTGCTTTTGTAGAGACATCCGCTCTTGAAGCCACCAATGTTGACAAGGCTTTTCA AACAATTCTTTCTGAGATATATAGGATTATTAGTAAGAAGACACTTTCTTCGGAAGAGTCAGCAGCACCTGTGAGTGTCAAAGATGGGAAGACCATTGTA GTTGGAGGACCCGATCCCAGCACTAAAAAGACGACCTGCTGCTCTTCTTCTTAG
AA sequence Show only first row Show all	>Potri.003G004100.1 pacid=42785631 polypeptide=Potri.003G004100.1.p locus=Potri.003G004100 ID=Potri.003G004100.1.v4.1 annot-version=v4.1 MARRPDEEYDYLFKVVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPTTF ENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAVATEDAQSYAEKEGLAFVETSALEATNVDKAFQTILSEIYRIISKKTLSSEESAAPVSVKDGKTIV VGGPDPSTKKTTCCSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.003G004100 [exp]	0	1
AT5G18900			2-oxoglutarate (2OG) and Fe(II...		Potri.008G197700 [exp]	2.00	0.8664
AT4G15802		AtHSBP	Arabidopsis thaliana heat shoc...		Potri.010G025000 [exp]	10.95	0.8200
AT3G43810		CAM7	calmodulin 7 (.1)		Potri.009G021500 [exp]	11.70	0.8685	Pt-ACCAL.1
AT2G37580			RING/U-box superfamily protein...		Potri.003G184800 [exp]	11.74	0.8100
AT1G60970			SNARE-like superfamily protein...		Potri.001G352900 [exp]	15.09	0.8287
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028200 [exp]	22.04	0.8458	Pt-ADF1.1
AT4G32150		ATVAMP711, VAMP...	vesicle-associated membrane pr...		Potri.018G025800 [exp]	25.09	0.8371	VAMP712.1
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Potri.001G222200 [exp]	30.00	0.8612	Pt-ACCAL.3
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.019G010400 [exp]	30.21	0.8362	PEAC14.4
AT2G42310			unknown protein		Potri.016G051400 [exp]	31.17	0.8589

Compare expression of checked genes

Potri.003G004100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.