Potri.003G004301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G182232 320 / 3e-112 ND /
Potri.006G172600 319 / 1e-111 ND /
Potri.001G165480 308 / 7e-107 AT1G52950 52 / 3e-07 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.019G061550 293 / 7e-98 AT1G52950 76 / 2e-14 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.001G320601 99 / 3e-26 ND /
Potri.006G279850 53 / 1e-09 ND /
Potri.018G096150 40 / 9e-05 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034056 52 / 3e-08 AT4G19130 47 / 4e-05 Replication factor-A protein 1-related (.1)
Lus10036312 48 / 1e-06 AT5G08020 67 / 3e-11 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10026445 41 / 0.0003 AT4G19130 41 / 0.002 Replication factor-A protein 1-related (.1)
Lus10023006 40 / 0.0005 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Representative CDS sequence
>Potri.003G004301.1 pacid=42784828 polypeptide=Potri.003G004301.1.p locus=Potri.003G004301 ID=Potri.003G004301.1.v4.1 annot-version=v4.1
ATGAATCCTTATGAGCACAAGCATCTAAGATTCACCTATCAAGCTTCGATTGTTGACTTTGATTTCCCCAATGGCTGGTGGTATCCAAGCTGTCCAAAAT
GCAACAAAAAACTTAGTGGGGGTGAAAAAAATTACACGTGCATGGATCATGATGCTATCACCTCTCTTCCAGTTCCATGGTTTCGCTTAGAATGCATTGT
TACCGATGGAGAAGATGTCACTAATTTTCTTATATTTGGGAAAACTGCGGAGAACTTTTTTGGATCATCAGCCCACCATTATGTCTATGATAAAAAATTT
ATTGATCCCTCAGTTCTTCCTCCTGCCATGGCAGCAAAGTTGAACAAAAGCATGATTTTTCAGCTTCGATTTGGTGCTTTCAGATCCATCACCAACAGAT
GTGAGGTTATCATTACTAATATCTTTGACGACACCACAAATAAGAGCATCCATCCTTTAGAAACACCAACTCCAGAACCTAAATCATCTGCTACATCCAA
GACATCTACTCCATTAAGCTCTATGAAATAG
AA sequence
>Potri.003G004301.1 pacid=42784828 polypeptide=Potri.003G004301.1.p locus=Potri.003G004301 ID=Potri.003G004301.1.v4.1 annot-version=v4.1
MNPYEHKHLRFTYQASIVDFDFPNGWWYPSCPKCNKKLSGGEKNYTCMDHDAITSLPVPWFRLECIVTDGEDVTNFLIFGKTAENFFGSSAHHYVYDKKF
IDPSVLPPAMAAKLNKSMIFQLRFGAFRSITNRCEVIITNIFDDTTNKSIHPLETPTPEPKSSATSKTSTPLSSMK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G004301 0 1
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Potri.001G261201 54.47 0.8218
AT4G02550 unknown protein Potri.006G196716 63.72 0.8308
AT5G61850 LFY LFY3, LFY LEAFY 3, floral meristem ident... Potri.015G106900 78.34 0.8293 Pt-LEAFY.1
Potri.001G132166 92.93 0.8185
AT1G17285 unknown protein Potri.001G162300 104.38 0.8228
AT5G20240 MADS PI, PISTILLATA PISTILLATA, K-box region and M... Potri.005G182200 135.63 0.7756 Pt-MADS2.2
AT1G11530 ATCXXS1 C-terminal cysteine residue is... Potri.011G031100 161.80 0.8070
Potri.005G192466 175.45 0.8010

Potri.003G004301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.