Potri.003G009500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15220 201 / 2e-67 Ribosomal protein L27 family protein (.1)
AT2G16930 199 / 2e-66 Ribosomal protein L27 family protein (.1.2.3)
AT5G40950 88 / 2e-22 RPL27 ribosomal protein large subunit 27 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G329500 96 / 2e-25 AT5G40950 253 / 2e-86 ribosomal protein large subunit 27 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007170 229 / 1e-78 AT5G15220 190 / 3e-63 Ribosomal protein L27 family protein (.1)
Lus10010822 228 / 4e-78 AT5G15220 191 / 3e-63 Ribosomal protein L27 family protein (.1)
Lus10041553 97 / 7e-26 AT5G40950 241 / 2e-81 ribosomal protein large subunit 27 (.1)
Lus10012538 96 / 4e-25 AT5G40950 243 / 2e-82 ribosomal protein large subunit 27 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01016 Ribosomal_L27 Ribosomal L27 protein
Representative CDS sequence
>Potri.003G009500.2 pacid=42787362 polypeptide=Potri.003G009500.2.p locus=Potri.003G009500 ID=Potri.003G009500.2.v4.1 annot-version=v4.1
ATGATGAATTTTACAACGATATTGTGCAAACGTTTGACTGTGAAGGAACTGGTCACCAATGTCCCCGTCTATGAAAGCATTGCTGATGGGTCTTCTGGTG
GATTAAGCTTGATGTTTAGACGTTGGGCTACCAAAAAACAAGCTGGGTCCACAAAGAATGGACGGGATTCGAAACCTAAGAACCTAGGGGTCAAGAAATT
TGGTGGAGAGAGGGTTATACCTGGAAATATCATAGTTCGGCAACGAGGCACTCGTTTTCATCCTGGAGACTATGTTGGGATGGGGAAAGATCACACGCTT
TTTGCCTTGAAGGAAGGAAATGTGAAGTTTGAAACAAACAAGCTTACAGGCCGCAAATGGGTGCATGTGGAGCCTAAGTATGGATATGAGCTCCATCCTA
TTTACACAAAAGCAAGTGGTGATTCAGCACAGGTGACAACAGCCTCATGA
AA sequence
>Potri.003G009500.2 pacid=42787362 polypeptide=Potri.003G009500.2.p locus=Potri.003G009500 ID=Potri.003G009500.2.v4.1 annot-version=v4.1
MMNFTTILCKRLTVKELVTNVPVYESIADGSSGGLSLMFRRWATKKQAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGMGKDHTL
FALKEGNVKFETNKLTGRKWVHVEPKYGYELHPIYTKASGDSAQVTTAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G15220 Ribosomal protein L27 family p... Potri.003G009500 0 1
AT1G04630 MEE4 maternal effect embryo arrest ... Potri.003G173800 9.05 0.8415
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.015G126301 14.21 0.8314
AT1G71950 Proteinase inhibitor, propepti... Potri.019G083300 20.44 0.7542
AT1G67785 unknown protein Potri.015G087301 21.90 0.8158
AT1G77370 Glutaredoxin family protein (.... Potri.007G017300 32.18 0.7546 PtrcGrx_C3
AT3G50845 Protein of unknown function (D... Potri.005G123100 35.49 0.7725
Potri.013G156300 35.58 0.8065
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Potri.004G131900 35.66 0.7833
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Potri.003G218700 38.72 0.7271
AT2G25310 Protein of unknown function (D... Potri.018G024600 42.89 0.7691

Potri.003G009500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.