Plant FIBer expression Database

Potri.003G009800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09794 98 / 4e-29 Cox19 family protein (CHCH motif) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019951
[exp]
54 / 1e-11 AT1G09794 54 / 1e-11 Cox19 family protein (CHCH motif) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF08991 MTCP1 Mature-T-Cell Proliferation I type
Representative CDS sequence
>Potri.003G009800.1 pacid=42787099 polypeptide=Potri.003G009800.1.p locus=Potri.003G009800 ID=Potri.003G009800.1.v4.1 annot-version=v4.1
ATGGCACAAGCAAGCAAAGAGCCGTGCAAGAAAGAAGCTTGCGATATTCAAGCTTGTCTCTCCAAAAACAACTTCCTCCCTCAGAAGTGCCTTAAAGTGA
TAGAAAATCTGCAGTCTTGCTGTGTGAAATGCGATTACAAGTCAACACATTGTGCTTCGGTGTCTGGCCTTCTGAAGCAAATGCCCAAGTGA
AA sequence
>Potri.003G009800.1 pacid=42787099 polypeptide=Potri.003G009800.1.p locus=Potri.003G009800 ID=Potri.003G009800.1.v4.1 annot-version=v4.1
MAQASKEPCKKEACDIQACLSKNNFLPQKCLKVIENLQSCCVKCDYKSTHCASVSGLLKQMPK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G09794 Cox19 family protein (CHCH mot... Potri.003G009800
[exp]
0 1
AT3G20740 FIE1, FIS3, FIE FERTILIZATION-INDEPENDENT ENDO... Potri.001G417300
[exp]
2.00 0.8145 FIE.1,PGE901
AT1G62350 Pentatricopeptide repeat (PPR)... Potri.001G275000
[exp]
6.16 0.7299
Potri.018G123400
[exp]
9.89 0.7869
AT5G14240 Thioredoxin superfamily protei... Potri.017G066200
[exp]
13.03 0.7472
AT4G38250 Transmembrane amino acid trans... Potri.009G167900
[exp]
18.84 0.7699 PtrANT3
AT5G37850 SOS4, ATSOS4 SALT OVERLY SENSITIVE 4, pfkB-... Potri.017G129000
[exp]
19.28 0.6831
AT3G12480 CCAAT NF-YC11 "nuclear factor Y, subunit C11... Potri.001G033200
[exp]
22.24 0.7792
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Potri.017G066900
[exp]
22.97 0.7071
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.002G219200
[exp]
24.55 0.6626
AT1G15270 Translation machinery associat... Potri.001G181800
[exp]
25.69 0.7553

Potri.003G009800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.