Potri.003G010532 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G010433 201 / 6e-69 ND /
Potri.003G010499 187 / 2e-63 ND /
Potri.003G010565 174 / 2e-58 ND /
Potri.003G010598 174 / 2e-58 ND /
Potri.003G010466 174 / 4e-58 ND /
Potri.003G010730 132 / 9e-42 ND /
Potri.003G010664 116 / 5e-35 ND /
Potri.004G221500 73 / 3e-18 ND /
Potri.004G221450 73 / 5e-18 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G010532.1 pacid=42787433 polypeptide=Potri.003G010532.1.p locus=Potri.003G010532 ID=Potri.003G010532.1.v4.1 annot-version=v4.1
ATGGAAATCTTCACAAAGCAACTCACCCCTATTGATTTTGATAGAGGATTGGTGCTACCACCCCGTTCTAACCTAGAACCCCTGCAACATTTTCAAGGGA
CCATAGAATTGTCCACCATAGTTGAGTCAGCTGCAGGAACCCGTTTACCGGAACCAGTGACAATTCACTGCTCAACCATAAGAGGAAGCCTTGTATTTAA
AACAGGTTGGTTTGGCATTGCTCACGATTTTGCCCTCAAAAGTGGAGATACTGTGACTTTCTATCAGGAGGTTAACGGAGGAGCGCAGTTCAAATTGAGA
GTGAGAAATGTTTGTTAA
AA sequence
>Potri.003G010532.1 pacid=42787433 polypeptide=Potri.003G010532.1.p locus=Potri.003G010532 ID=Potri.003G010532.1.v4.1 annot-version=v4.1
MEIFTKQLTPIDFDRGLVLPPRSNLEPLQHFQGTIELSTIVESAAGTRLPEPVTIHCSTIRGSLVFKTGWFGIAHDFALKSGDTVTFYQEVNGGAQFKLR
VRNVC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G010532 0 1
Potri.006G260948 3.46 0.9997
AT3G27890 NQR NADPH:quinone oxidoreductase (... Potri.003G195900 4.89 0.9997 NQR.1
Potri.003G010499 5.29 0.9997
Potri.006G261111 5.65 0.9996
AT2G15220 Plant basic secretory protein ... Potri.009G094500 6.70 0.9997
Potri.003G010466 6.92 0.9994
AT5G42650 CYP74A, AOS, DD... DELAYED DEHISCENCE 2, CYTOCHRO... Potri.004G148600 7.54 0.9996
AT5G42650 CYP74A, AOS, DD... DELAYED DEHISCENCE 2, CYTOCHRO... Potri.004G148900 7.74 0.9997
AT1G30890 Integral membrane HRF1 family ... Potri.001G327700 8.66 0.9997
Potri.001G439900 10.39 0.9996

Potri.003G010532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.